(data stored in SCRATCH zone)

EMBL: CP001778.PE128

CP001778.PE128       Location/Qualifiers
FT   CDS             136690..137139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0130"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: dde:Dde_1410 50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39851"
FT                   /db_xref="GOA:D3Q1K3"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1K3"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ADD39851.1"
FT                   /translation="MKLILTREVSGLGEPGDVVEVKNGYGRNYLIPQRFATPWTKGGQK
FT                   QVDQIKRARTAREVRDADHAREIHEQLAAVNVKLTARAGTGGRLFGSITPAEITDAVEA
FT                   AGGPKLDRRRLELPGHIKAVGSHEVAIKLHPEVRSTFKIEVVAAK"
     MKLILTREVS GLGEPGDVVE VKNGYGRNYL IPQRFATPWT KGGQKQVDQI KRARTAREVR        60
     DADHAREIHE QLAAVNVKLT ARAGTGGRLF GSITPAEITD AVEAAGGPKL DRRRLELPGH       120
     IKAVGSHEVA IKLHPEVRST FKIEVVAAK                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page