(data stored in SCRATCH zone)

EMBL: CP001778.PE137

CP001778.PE137       Location/Qualifiers
FT   CDS             143385..143750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39860"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39860.1"
FT                   /translation="MKSLTSRVLTLGATGALAVAIFSGCSLVQGAVDCATVGETMSKIA
FT                   SNVGGDEKTLKKYTKELRDEAKNIEDADLKKSAEDFADEAESVNAGLNGDLQGGAETEA
FT                   DKLQGSADKFLEKCNAL"
     MKSLTSRVLT LGATGALAVA IFSGCSLVQG AVDCATVGET MSKIASNVGG DEKTLKKYTK        60
     ELRDEAKNIE DADLKKSAED FADEAESVNA GLNGDLQGGA ETEADKLQGS ADKFLEKCNA       120
     L                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page