(data stored in SCRATCH zone)

EMBL: CP001778.PE140

CP001778.PE140       Location/Qualifiers
FT   CDS             146110..146475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39863"
FT                   /db_xref="GOA:D3Q1L5"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1L5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39863.1"
FT                   /translation="MVSRPGEDNAVPGLPEEWGRIVIPDDASDLEELADEVRFELGITE
FT                   DPVEERRQRRLPFIVVAVTVAIALVSLFTVPWLGRVGQVTPPKQTISSTVESESVPECA
FT                   TGQTRCATTSRSTVSSG"
     MVSRPGEDNA VPGLPEEWGR IVIPDDASDL EELADEVRFE LGITEDPVEE RRQRRLPFIV        60
     VAVTVAIALV SLFTVPWLGR VGQVTPPKQT ISSTVESESV PECATGQTRC ATTSRSTVSS       120
     G                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page