(data stored in SCRATCH zone)

EMBL: CP001778.PE154

CP001778.PE154       Location/Qualifiers
FT   CDS             159713..162115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0157"
FT                   /product="cell division FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: dac:Daci_4199
FT                   cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39877"
FT                   /db_xref="GOA:D3Q1M9"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1M9"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADD39877.1"
FT                   /translation="MAGLRATFDNTVARHLSAVGRLNAVRAALDAAPPSGPDAASVAAE
FT                   TALAQRLSAAAAALRDDPGLVHIGQARLHASSFPVLVPFIGTGHLAFSHDSREPRVAAL
FT                   MRAILLRAMASAQPGQLEIEAVDAATVGASLAALQPLADARLMRVTTDAAGLERALAAC
FT                   EDHVKSVLRGERSTKLVLALASTPELNEDLRGRVDALARSGVAGGVHLLAGGFEQLPTA
FT                   VTIQVADDMRVGNPPDAPIGAAGLNAPVAFDRPLTDDYVRAEATRVADRAKAAAELRFA
FT                   DLAPDRLWSEDPSDGLSTLAGRDSQGVLRLSFDDETPHWLVGGRTGGGKTVFLLDILYG
FT                   LAARYSPEDLALYLLDFKEGVSFTEFTPQSADSTFIPHARAVGVESDREYGVAILRELD
FT                   AEMTRRSVVMKRHGVARYSQLRGAESLPRILCVVDEFQVLFAGNDKLAREAVGLLENLA
FT                   RKGRSYGVHMILASQTTSGIEALYTKKDSIFGQFPLRVALPGATSVLDHLNPAAQGLRT
FT                   GEVVINADGGIAGRDRKVRFPNAHAESELLYQLRHDMWSARRDAQPPTVFYGYAAAHLD
FT                   EDPRLAELTETPRPRVLLGRRVNAALDTAEITLDNTPGRHLSILGADPTGAHLLNAAAI
FT                   SLAKQRPQARYVVAALAEPGLAQATATALGEQAELVAADDLATVMAELTEAAQPAFLIG
FT                   FGLDAANLTMDGKKALTTLLRTGPASGVHLLGWWRGLRRFTDDIGGSAGREDVSCSVVL
FT                   NVPGNELMGHFGQSVMDWNPRPGRGLLIDRHANRHDLMVPYTLRETE"
     MAGLRATFDN TVARHLSAVG RLNAVRAALD AAPPSGPDAA SVAAETALAQ RLSAAAAALR        60
     DDPGLVHIGQ ARLHASSFPV LVPFIGTGHL AFSHDSREPR VAALMRAILL RAMASAQPGQ       120
     LEIEAVDAAT VGASLAALQP LADARLMRVT TDAAGLERAL AACEDHVKSV LRGERSTKLV       180
     LALASTPELN EDLRGRVDAL ARSGVAGGVH LLAGGFEQLP TAVTIQVADD MRVGNPPDAP       240
     IGAAGLNAPV AFDRPLTDDY VRAEATRVAD RAKAAAELRF ADLAPDRLWS EDPSDGLSTL       300
     AGRDSQGVLR LSFDDETPHW LVGGRTGGGK TVFLLDILYG LAARYSPEDL ALYLLDFKEG       360
     VSFTEFTPQS ADSTFIPHAR AVGVESDREY GVAILRELDA EMTRRSVVMK RHGVARYSQL       420
     RGAESLPRIL CVVDEFQVLF AGNDKLAREA VGLLENLARK GRSYGVHMIL ASQTTSGIEA       480
     LYTKKDSIFG QFPLRVALPG ATSVLDHLNP AAQGLRTGEV VINADGGIAG RDRKVRFPNA       540
     HAESELLYQL RHDMWSARRD AQPPTVFYGY AAAHLDEDPR LAELTETPRP RVLLGRRVNA       600
     ALDTAEITLD NTPGRHLSIL GADPTGAHLL NAAAISLAKQ RPQARYVVAA LAEPGLAQAT       660
     ATALGEQAEL VAADDLATVM AELTEAAQPA FLIGFGLDAA NLTMDGKKAL TTLLRTGPAS       720
     GVHLLGWWRG LRRFTDDIGG SAGREDVSCS VVLNVPGNEL MGHFGQSVMD WNPRPGRGLL       780
     IDRHANRHDL MVPYTLRETE                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page