(data stored in SCRATCH zone)

EMBL: CP001778.PE167

CP001778.PE167       Location/Qualifiers
FT   CDS             complement(172062..173144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0170"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: ara:Arad_9759 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39890"
FT                   /db_xref="GOA:D3Q1P2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD39890.1"
FT                   /translation="MADISIRNLSRTYSGQKAPATDDVSLDVADGEFMVFLGPSGCGKT
FT                   TLLRMIAGLELPDAGSVAIGGKDVTYLAPRNRNLSMVFQSYAVFPHRRVRANIGFGLKM
FT                   RGVAADEIARRVDRAADLLQLTDYLDRYPAQLSGGQRQRVAVARAIVVDADVLLMDEPL
FT                   SNLDALLRLSFRAELKKIVAELGTTTVYVTHDQAEALSLGDRVAVMRSGRIVQQGGPID
FT                   VYDSPADTFVGGFLGSPPMNFLDGEVADGPKLRVGEQSLAVPSALASFAGQPVKLGVRA
FT                   ENITVSQSRDESAVPATVDVVEPVGASVLLTVTVDGQELKVQAPPTFRIDPGATAWLTF
FT                   PADRLRFYDPESAMALETDR"
     MADISIRNLS RTYSGQKAPA TDDVSLDVAD GEFMVFLGPS GCGKTTLLRM IAGLELPDAG        60
     SVAIGGKDVT YLAPRNRNLS MVFQSYAVFP HRRVRANIGF GLKMRGVAAD EIARRVDRAA       120
     DLLQLTDYLD RYPAQLSGGQ RQRVAVARAI VVDADVLLMD EPLSNLDALL RLSFRAELKK       180
     IVAELGTTTV YVTHDQAEAL SLGDRVAVMR SGRIVQQGGP IDVYDSPADT FVGGFLGSPP       240
     MNFLDGEVAD GPKLRVGEQS LAVPSALASF AGQPVKLGVR AENITVSQSR DESAVPATVD       300
     VVEPVGASVL LTVTVDGQEL KVQAPPTFRI DPGATAWLTF PADRLRFYDP ESAMALETDR       360
//

If you have problems or comments...

PBIL Back to PBIL home page