(data stored in SCRATCH zone)

EMBL: CP001778.PE17

CP001778.PE17        Location/Qualifiers
FT   CDS             22138..23130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0018"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bra:BRADO6558 putative short-chain
FT                   dehydrogenases/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39740"
FT                   /db_xref="GOA:D3PTY2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD39740.1"
FT                   /translation="MNDGTHPDDHADEPAATDDTPTAPKPGRRYTRRRLLTTSAVAAGA
FT                   AAVAVGTTAVLTNDGTPPTIKPSGRNRFDGKVVIVTGATSGIGRAAAKLFAAEGAKVGF
FT                   CGRREKLGAEVEREIRSDGGEATYIRADVRKESQVRKFVDRVADEYGGLDVCFNNAGIT
FT                   LQKPLHEYTAAEWDDVVDTNLRGTFLCMKYEVPHLIERGGGSVVITSSSNVHSTGEERS
FT                   AYTASKHGLLGLANCAAYDYAEHNIRVNTLIPGTTNTELVRRVAGAMDLPDAVWEEMAA
FT                   AYGRANAPTMKRLATPEEIAVGALALASPDFSYMTAGSLTLDGGDSNRG"
     MNDGTHPDDH ADEPAATDDT PTAPKPGRRY TRRRLLTTSA VAAGAAAVAV GTTAVLTNDG        60
     TPPTIKPSGR NRFDGKVVIV TGATSGIGRA AAKLFAAEGA KVGFCGRREK LGAEVEREIR       120
     SDGGEATYIR ADVRKESQVR KFVDRVADEY GGLDVCFNNA GITLQKPLHE YTAAEWDDVV       180
     DTNLRGTFLC MKYEVPHLIE RGGGSVVITS SSNVHSTGEE RSAYTASKHG LLGLANCAAY       240
     DYAEHNIRVN TLIPGTTNTE LVRRVAGAMD LPDAVWEEMA AAYGRANAPT MKRLATPEEI       300
     AVGALALASP DFSYMTAGSL TLDGGDSNRG                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page