(data stored in SCRATCH zone)

EMBL: CP001778.PE172

CP001778.PE172       Location/Qualifiers
FT   CDS             complement(177744..178439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39895"
FT                   /db_xref="GOA:D3Q1P7"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39895.1"
FT                   /translation="MSAISKSDRITTGLAGLLSGVLSILMVGLYFVYDGAPPPENVLGR
FT                   NLITVTTFIGFLIFGAGLARLLRQARGGDAGLSGSIAVTSLLTYVAVTLVSASLEVGTS
FT                   LWKPNSDMDPTVDGPLAAGMVLLHGPIARGLVAAFLITLTISAARTGLLRRWVLTGNII
FT                   LALTNLALVPSLFFGMNAANFYAANGWGAVASIGLINVIWFATLGGALLRSRAARQTPV
FT                   PTPAPAPTR"
     MSAISKSDRI TTGLAGLLSG VLSILMVGLY FVYDGAPPPE NVLGRNLITV TTFIGFLIFG        60
     AGLARLLRQA RGGDAGLSGS IAVTSLLTYV AVTLVSASLE VGTSLWKPNS DMDPTVDGPL       120
     AAGMVLLHGP IARGLVAAFL ITLTISAART GLLRRWVLTG NIILALTNLA LVPSLFFGMN       180
     AANFYAANGW GAVASIGLIN VIWFATLGGA LLRSRAARQT PVPTPAPAPT R                231
//

If you have problems or comments...

PBIL Back to PBIL home page