(data stored in SCRATCH zone)

EMBL: CP001778.PE174

CP001778.PE174       Location/Qualifiers
FT   CDS             178952..180112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0177"
FT                   /product="histidine kinase dimerization and phosphoacceptor
FT                   region"
FT                   /note="PFAM: histidine kinase dimerisation and
FT                   phosphoacceptor region; KEGG: scl:sce5432 putative
FT                   two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39897"
FT                   /db_xref="GOA:D3Q1P9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1P9"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADD39897.1"
FT                   /translation="MERDAEAEPADTSTGGRWDPAGLVLTVLPALAAFAGGLAQLYWVL
FT                   LAGPVGTMRWVDIGCGAAACFVLLFRSRARTGIAIALAVVAAFAATGGVANMVALYGVA
FT                   RYRRLPVALAVGAADVLAGYCFWLVYPENNKLSLTLVVNVAIVAAIVAWGAMRQTQESL
FT                   LLSYRERAERAEREQRLRETQIRQAERTRIAREMHDVVTHRISLVALHAGGLMVDPEPK
FT                   IDVVRGSAELIYGSARQALEELRLALGALRADEPTSLEQPGLDRIQDLVEDALRAGQEV
FT                   ELDMDPAIVETAPPGIGRDAYRFVQEGLANVRKHAPNAVAVVTVAAADGVLRVRVVNEM
FT                   VDGSLGVPGAGAGLIGLRERADLAGGTLSHGPVDGRFELVGELPWT"
     MERDAEAEPA DTSTGGRWDP AGLVLTVLPA LAAFAGGLAQ LYWVLLAGPV GTMRWVDIGC        60
     GAAACFVLLF RSRARTGIAI ALAVVAAFAA TGGVANMVAL YGVARYRRLP VALAVGAADV       120
     LAGYCFWLVY PENNKLSLTL VVNVAIVAAI VAWGAMRQTQ ESLLLSYRER AERAEREQRL       180
     RETQIRQAER TRIAREMHDV VTHRISLVAL HAGGLMVDPE PKIDVVRGSA ELIYGSARQA       240
     LEELRLALGA LRADEPTSLE QPGLDRIQDL VEDALRAGQE VELDMDPAIV ETAPPGIGRD       300
     AYRFVQEGLA NVRKHAPNAV AVVTVAAADG VLRVRVVNEM VDGSLGVPGA GAGLIGLRER       360
     ADLAGGTLSH GPVDGRFELV GELPWT                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page