(data stored in SCRATCH zone)

EMBL: CP001778.PE184

CP001778.PE184       Location/Qualifiers
FT   CDS             complement(187115..192031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0188"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: pfl:PFL_2147 nonribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39907"
FT                   /db_xref="GOA:D3Q1Q9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1Q9"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADD39907.1"
FT                   /translation="MTSPRELATVPDLLRANTDAHPDRIAVSAGDGRWTYTELLARASR
FT                   LATALGDAGVRPGDLVGVCMPRGRDGIAALLATWAAGAAYLPLDPSYPRHRLEYLAADS
FT                   GFTALLTTTGLADRVPVPSGVPVIDTDTVPDALAPTAWPHRPQPSDLAYVIYTSGSTGE
FT                   PKGVMVEHAALTNLVRWHGEAFDITTADRCSHIAAAGFDASVWEIWSALANGAALHVIP
FT                   EDIRQSFDEAIDWCAAEAVTVAFLPTVMAEHLLRRPADDRLALRVLLTGGDRLRLHPGD
FT                   HPFTLVNNYGPTECTVVATSTVVKPHPGDTAAVPSIGQAIDNTRIHLINEDGQPDERGE
FT                   IWICGAGLARGYLGLPELTAERFVTGPDGERAYRTGDLAHRNPDGSLVFLGRVDDQVKI
FT                   RGYRVELGEIDTALRWLDGVADCVTVARPDAVGEQRLISYVVPEPGREAPRLREALAEL
FT                   LPSYMVPAVFVELDALPVSANGKLDRDALPEPHGFEALTDERPAGPSSAAPSGTAPVEL
FT                   LTSLFAEVLGTPAVGTDTDFFDAGGHSLQLTMLLARIRDRFGIELKYRDLFAAATPSAL
FT                   AQLLGNHSPAPDDPAPTPAEADAPVPLSPAQQQLWLTSQLASGTAVNNVFKSYRVEGSI
FT                   DVPALEWALAETVRRHEVLRTRFDVLDDEPVQVIAPPWQPRVELIEATDVPDAVTAFVT
FT                   RPFDVAALPLLRLAIMRGDETQLAIVLHHLITDGWSLELFLAEVAGHYRDRTTGTVTDL
FT                   PAPKQYGDFARAQRARMASSALKQSRAEYVTTLSDFPQLLELPADRPRPPERDFATDTV
FT                   HFGVPAEVADKLERLGREHGATRFMTLLAACDVLLHRWSGQERFLVGTPVANRTTVDSE
FT                   STLGFFVNTLVLPADLSGDPDFGDLLDRVTGSSLAAFTRQEVPFADLVDDLDPQRSLAH
FT                   NPLVQVLFSLQDVPATRLDLPGAELTEQPETVGATPFDLAVHLTPTAHGLTGELRYATE
FT                   LFDRATVERIAAQFNQLLESIADDPHQRVGGIDLLPAAERAELAALGTGPIRHPDPTVV
FT                   PWKIRRIAEQPPDRVAVEDADGTWTYAELMHQVRALSVILRERGVGPESLVGVCMRRDR
FT                   MLLASLLAVWMCGGAFIPMDPSYPRKRLEYMIADSRPTVLLATPETAATLDVGDVDIVL
FT                   PGQHPAPDDADWPDVDITGANLAYVMYTSGSTGNPKGVMVEHSNLVNLLDAYAADPGFG
FT                   PEDRLLALSSLSFDPAVRELTLPLTVGGRVIIAPEVTADPDELDALLRRGATHFGATPG
FT                   VMKLYTSHTAKLPDTVRLLFCGGETISDALAEALLDLGITVLHGYGPTETTVSVCFAPV
FT                   TADTPISIGRPIANTRLHVVDPAGRLVPRGVPGELVISGAGVGRGYLHRPDLTAERFRP
FT                   APDGSRGYHTGDLVRWTGDGNLKFLGRTDNQVKINGCRVELGEVDATVRDFPGVRDNLT
FT                   VTRDDPSGGKRLVTYVLAQPGHRLDTAALHASAVESLPTHMLPSAWAILDAFPLNPNGK
FT                   VDVSALPDPSPSHANQEPPTTATELALAAIWHDVLGTPTPTRDADFFTSGGHSLAAMRV
FT                   VTRIRERLHPDVALRDIFAHPRLRDLASHLDGLTDTEPATPAIGRVDRSKHRLDASRLS
FT                   "
     MTSPRELATV PDLLRANTDA HPDRIAVSAG DGRWTYTELL ARASRLATAL GDAGVRPGDL        60
     VGVCMPRGRD GIAALLATWA AGAAYLPLDP SYPRHRLEYL AADSGFTALL TTTGLADRVP       120
     VPSGVPVIDT DTVPDALAPT AWPHRPQPSD LAYVIYTSGS TGEPKGVMVE HAALTNLVRW       180
     HGEAFDITTA DRCSHIAAAG FDASVWEIWS ALANGAALHV IPEDIRQSFD EAIDWCAAEA       240
     VTVAFLPTVM AEHLLRRPAD DRLALRVLLT GGDRLRLHPG DHPFTLVNNY GPTECTVVAT       300
     STVVKPHPGD TAAVPSIGQA IDNTRIHLIN EDGQPDERGE IWICGAGLAR GYLGLPELTA       360
     ERFVTGPDGE RAYRTGDLAH RNPDGSLVFL GRVDDQVKIR GYRVELGEID TALRWLDGVA       420
     DCVTVARPDA VGEQRLISYV VPEPGREAPR LREALAELLP SYMVPAVFVE LDALPVSANG       480
     KLDRDALPEP HGFEALTDER PAGPSSAAPS GTAPVELLTS LFAEVLGTPA VGTDTDFFDA       540
     GGHSLQLTML LARIRDRFGI ELKYRDLFAA ATPSALAQLL GNHSPAPDDP APTPAEADAP       600
     VPLSPAQQQL WLTSQLASGT AVNNVFKSYR VEGSIDVPAL EWALAETVRR HEVLRTRFDV       660
     LDDEPVQVIA PPWQPRVELI EATDVPDAVT AFVTRPFDVA ALPLLRLAIM RGDETQLAIV       720
     LHHLITDGWS LELFLAEVAG HYRDRTTGTV TDLPAPKQYG DFARAQRARM ASSALKQSRA       780
     EYVTTLSDFP QLLELPADRP RPPERDFATD TVHFGVPAEV ADKLERLGRE HGATRFMTLL       840
     AACDVLLHRW SGQERFLVGT PVANRTTVDS ESTLGFFVNT LVLPADLSGD PDFGDLLDRV       900
     TGSSLAAFTR QEVPFADLVD DLDPQRSLAH NPLVQVLFSL QDVPATRLDL PGAELTEQPE       960
     TVGATPFDLA VHLTPTAHGL TGELRYATEL FDRATVERIA AQFNQLLESI ADDPHQRVGG      1020
     IDLLPAAERA ELAALGTGPI RHPDPTVVPW KIRRIAEQPP DRVAVEDADG TWTYAELMHQ      1080
     VRALSVILRE RGVGPESLVG VCMRRDRMLL ASLLAVWMCG GAFIPMDPSY PRKRLEYMIA      1140
     DSRPTVLLAT PETAATLDVG DVDIVLPGQH PAPDDADWPD VDITGANLAY VMYTSGSTGN      1200
     PKGVMVEHSN LVNLLDAYAA DPGFGPEDRL LALSSLSFDP AVRELTLPLT VGGRVIIAPE      1260
     VTADPDELDA LLRRGATHFG ATPGVMKLYT SHTAKLPDTV RLLFCGGETI SDALAEALLD      1320
     LGITVLHGYG PTETTVSVCF APVTADTPIS IGRPIANTRL HVVDPAGRLV PRGVPGELVI      1380
     SGAGVGRGYL HRPDLTAERF RPAPDGSRGY HTGDLVRWTG DGNLKFLGRT DNQVKINGCR      1440
     VELGEVDATV RDFPGVRDNL TVTRDDPSGG KRLVTYVLAQ PGHRLDTAAL HASAVESLPT      1500
     HMLPSAWAIL DAFPLNPNGK VDVSALPDPS PSHANQEPPT TATELALAAI WHDVLGTPTP      1560
     TRDADFFTSG GHSLAAMRVV TRIRERLHPD VALRDIFAHP RLRDLASHLD GLTDTEPATP      1620
     AIGRVDRSKH RLDASRLS                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page