(data stored in SCRATCH zone)

EMBL: CP001778.PE186

CP001778.PE186       Location/Qualifiers
FT   CDS             complement(193279..194028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0190"
FT                   /product="Thioesterase"
FT                   /note="PFAM: Thioesterase; KEGG: dac:Daci_4759
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39909"
FT                   /db_xref="GOA:D3Q1R1"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR012223"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R1"
FT                   /inference="protein motif:PFAM:PF00975"
FT                   /protein_id="ADD39909.1"
FT                   /translation="MHIRTVTPKPAARVHLIGFPGAGGSQTHFRRWDSALGPWIRLSVV
FT                   DPWSLYFAAQAAEVDSLPDLASLLLPELAVSDSRFVLAGHSFGALLAYETARQLDEGRH
FT                   GDRLAGLVAMAQRAPTTPAPERISHLGDDRLLRFLRDMGGTPEEVFAEPELLDLLLGRL
FT                   RDEIRLSERYRDTRAEPLDRPLRVYFGDQDSGIAPIEARKWTKSVTGDHVLRTFPGGHF
FT                   FPFDDFQVVSALLEDTLTKEPLHDIQN"
     MHIRTVTPKP AARVHLIGFP GAGGSQTHFR RWDSALGPWI RLSVVDPWSL YFAAQAAEVD        60
     SLPDLASLLL PELAVSDSRF VLAGHSFGAL LAYETARQLD EGRHGDRLAG LVAMAQRAPT       120
     TPAPERISHL GDDRLLRFLR DMGGTPEEVF AEPELLDLLL GRLRDEIRLS ERYRDTRAEP       180
     LDRPLRVYFG DQDSGIAPIE ARKWTKSVTG DHVLRTFPGG HFFPFDDFQV VSALLEDTLT       240
     KEPLHDIQN                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page