(data stored in SCRATCH zone)

EMBL: CP001778.PE193

CP001778.PE193       Location/Qualifiers
FT   CDS             complement(211220..212146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0197"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A1475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39916"
FT                   /db_xref="InterPro:IPR021889"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1R8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39916.1"
FT                   /translation="MRQAARRLREALTDEQADAAFHPFADADRTRWDYRPRPRPGACIG
FT                   EFGLTGRKRAHQLLATAMSPHAFAQITTIMGLEEVLDRAESWRRGRHSDDFWIAVFGSP
FT                   EDEAWAWRFEGHHVSVSMTVVAEEVSPTPVFLGANPASVDYRGTPVVRPLAIEEELARD
FT                   LLARLPDRQRAQAIVSPVAPSDIRTGNARDITDIDRWPGLRAADLSRGNAEILDRLIDV
FT                   YLDRLPPSLAAAERAVIEPDAIHFAWEGSAERGGGHYYRLQSPRLLIEYDNTQNDANHV
FT                   HTVLRRPGDDFGRGLLPSHVASEREPR"
     MRQAARRLRE ALTDEQADAA FHPFADADRT RWDYRPRPRP GACIGEFGLT GRKRAHQLLA        60
     TAMSPHAFAQ ITTIMGLEEV LDRAESWRRG RHSDDFWIAV FGSPEDEAWA WRFEGHHVSV       120
     SMTVVAEEVS PTPVFLGANP ASVDYRGTPV VRPLAIEEEL ARDLLARLPD RQRAQAIVSP       180
     VAPSDIRTGN ARDITDIDRW PGLRAADLSR GNAEILDRLI DVYLDRLPPS LAAAERAVIE       240
     PDAIHFAWEG SAERGGGHYY RLQSPRLLIE YDNTQNDANH VHTVLRRPGD DFGRGLLPSH       300
     VASEREPR                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page