(data stored in SCRATCH zone)

EMBL: CP001778.PE21

CP001778.PE21        Location/Qualifiers
FT   CDS             26946..28607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0022"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: mxa:MXAN_5903 TrkA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39744"
FT                   /db_xref="GOA:D3PTY6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTY6"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADD39744.1"
FT                   /translation="MAFRLVEELVFRHRENVTVILPSRRRNHGPQISRVPTVRVVENDQ
FT                   LDADAFSSARITQAKALALMAQDDVGNIHAALRALEITEIRVVVRCFNTNLGNRIEPLL
FT                   GDCTLLSDASMASPSFVAAALGEVAPRYSQVLGRTLYVTASASDRGDRLTWPIAGGPDE
FT                   GVLLPGEEVEPSLFVTVATRRPRRALVTASKHRVRSLATRLWDELREILDRKLRFITLF
FT                   LVAVIVLGSFLIWNSHKGDGQSFGWLESAYVVILAAAGGIDPVTGAEFAEKFAHVLVAI
FT                   SGVLLVPIFTASIVENMVGRRLAAEAGRLRGPISDHVIVVGLGNVGTRIAVQLRNLGVP
FT                   VVAIERNARCHGVDVARSQDIPVVYGDASQLETLHAAQVRTCRSLVAVTSNDIVNLEAA
FT                   LHARSIRQDLRTVLRLFEQDLAERVQKHFDISASLSVAGVAAAEFAAAMTDRNVKGTIP
FT                   VGRHLVLIGEFTVEDGSELAGQPLSQIDADESLRVLAISKVDETDWAPDPQRLMDPGDT
FT                   VLVLATRRGLAATVRRAAPSTGPEEPRLGQPSPFRP"
     MAFRLVEELV FRHRENVTVI LPSRRRNHGP QISRVPTVRV VENDQLDADA FSSARITQAK        60
     ALALMAQDDV GNIHAALRAL EITEIRVVVR CFNTNLGNRI EPLLGDCTLL SDASMASPSF       120
     VAAALGEVAP RYSQVLGRTL YVTASASDRG DRLTWPIAGG PDEGVLLPGE EVEPSLFVTV       180
     ATRRPRRALV TASKHRVRSL ATRLWDELRE ILDRKLRFIT LFLVAVIVLG SFLIWNSHKG       240
     DGQSFGWLES AYVVILAAAG GIDPVTGAEF AEKFAHVLVA ISGVLLVPIF TASIVENMVG       300
     RRLAAEAGRL RGPISDHVIV VGLGNVGTRI AVQLRNLGVP VVAIERNARC HGVDVARSQD       360
     IPVVYGDASQ LETLHAAQVR TCRSLVAVTS NDIVNLEAAL HARSIRQDLR TVLRLFEQDL       420
     AERVQKHFDI SASLSVAGVA AAEFAAAMTD RNVKGTIPVG RHLVLIGEFT VEDGSELAGQ       480
     PLSQIDADES LRVLAISKVD ETDWAPDPQR LMDPGDTVLV LATRRGLAAT VRRAAPSTGP       540
     EEPRLGQPSP FRP                                                          553
//

If you have problems or comments...

PBIL Back to PBIL home page