(data stored in SCRATCH zone)

EMBL: CP001778.PE216

CP001778.PE216       Location/Qualifiers
FT   CDS             complement(234242..235288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39939"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q1U1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39939.1"
FT                   /translation="MPHPVLDLSSASRDVYLSPSRLSRETELIGELYALLEPQLNVLAD
FT                   DIEDDPDLAEAIEAVRTIAAGGRADADTAHELLTGWAEELEETGDHDDAITARIVWLVA
FT                   AWLSVKVGRHLRTEAGSDPLWRFGGLVNVLALPRLGKDFREVMAAVDETGFHDAHRPAV
FT                   SGEHYDRALEAVVAELSKLDSAKRLDVLYAWISPLLDEVAWENREFMDEPEMETAEAVE
FT                   RFRRLASGDTPDDGDEADAVHYHLTSFALGESEDQDPDMHVRSQAAYLAADWLRLKTGR
FT                   QLRADENLGNYAPDDLPGLVNTLAWTRSRQISQLPEYVDELIDSGHDLLTPITELRAML
FT                   TDLTSPSD"
     MPHPVLDLSS ASRDVYLSPS RLSRETELIG ELYALLEPQL NVLADDIEDD PDLAEAIEAV        60
     RTIAAGGRAD ADTAHELLTG WAEELEETGD HDDAITARIV WLVAAWLSVK VGRHLRTEAG       120
     SDPLWRFGGL VNVLALPRLG KDFREVMAAV DETGFHDAHR PAVSGEHYDR ALEAVVAELS       180
     KLDSAKRLDV LYAWISPLLD EVAWENREFM DEPEMETAEA VERFRRLASG DTPDDGDEAD       240
     AVHYHLTSFA LGESEDQDPD MHVRSQAAYL AADWLRLKTG RQLRADENLG NYAPDDLPGL       300
     VNTLAWTRSR QISQLPEYVD ELIDSGHDLL TPITELRAML TDLTSPSD                    348
//

If you have problems or comments...

PBIL Back to PBIL home page