(data stored in SCRATCH zone)

EMBL: CP001778.PE226

CP001778.PE226       Location/Qualifiers
FT   CDS             245292..245846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0230"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mlo:mlr0926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39949"
FT                   /db_xref="GOA:D3Q2X9"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2X9"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADD39949.1"
FT                   /translation="MARLVYSAIMSLDGYIADENGEFGWAMPSDEVHGFINDRMRSIGT
FT                   HLYGRVLYETMTGWETDPSLAEQPLGRDFAEQWQAADKIVYSTTLDKPVTAKTRIEREF
FT                   DPVVVQGLKDTAEADLLIGGPVLAAHAFAAGLVDVCELYVVPVIVGGGHLGLPEGLFLN
FT                   LELLEERRFANGFVLLRYKVG"
     MARLVYSAIM SLDGYIADEN GEFGWAMPSD EVHGFINDRM RSIGTHLYGR VLYETMTGWE        60
     TDPSLAEQPL GRDFAEQWQA ADKIVYSTTL DKPVTAKTRI EREFDPVVVQ GLKDTAEADL       120
     LIGGPVLAAH AFAAGLVDVC ELYVVPVIVG GGHLGLPEGL FLNLELLEER RFANGFVLLR       180
     YKVG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page