(data stored in SCRATCH zone)

EMBL: CP001778.PE231

CP001778.PE231       Location/Qualifiers
FT   CDS             complement(250443..252125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0235"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   scl:sce1630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39954"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y4"
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /protein_id="ADD39954.1"
FT                   /translation="MRQIDEIAETYVAEALELSPMTATYMGVEGHDHEFDDLSPEGLAR
FT                   QAALVRDTLSKLSATEPVDERERVAKEGMEERLGLELERHEAGDEYLSLNVISSGVHNV
FT                   RQVFDMMNTDGQDNAANIAARLNAVPQALRQYTQTLREEAAAGRVAALRQVSEVAGHCD
FT                   NWNGAKGDDFWNGLIGKVTVDGKPAEGALAEALGSGAAAARAATAEFASFLREELAPKA
FT                   PSKDAVGRDAYSRGSRYFLGAAVDLEETYAWGWQELHRIETEMAAVANQIKPGATVDEA
FT                   VAILDADPARSISDKHEFRDWMQQLADATVADMADKHFDIPEPVRAIECMIAPTADGAI
FT                   YYTPPSEDFSRPGRMWWSVPDGQDHFAKWREVTTVYHEGVPGHHLQIGQTAYRSELLNR
FT                   YQRQMLWCSGHGEGWALYSERLMDDLGYLADPGDKLGMLDGQAFRATRVIVDIGVHLEL
FT                   EIPADNPFGFRPGQRWNAELAWEFLRAHCRIEEEMLKFELNRYLGWPGQAPSYKVGERI
FT                   WLAAREDYKRRKGAEFNLKQFHTDALNLGALGLEPFQAALARL"
     MRQIDEIAET YVAEALELSP MTATYMGVEG HDHEFDDLSP EGLARQAALV RDTLSKLSAT        60
     EPVDERERVA KEGMEERLGL ELERHEAGDE YLSLNVISSG VHNVRQVFDM MNTDGQDNAA       120
     NIAARLNAVP QALRQYTQTL REEAAAGRVA ALRQVSEVAG HCDNWNGAKG DDFWNGLIGK       180
     VTVDGKPAEG ALAEALGSGA AAARAATAEF ASFLREELAP KAPSKDAVGR DAYSRGSRYF       240
     LGAAVDLEET YAWGWQELHR IETEMAAVAN QIKPGATVDE AVAILDADPA RSISDKHEFR       300
     DWMQQLADAT VADMADKHFD IPEPVRAIEC MIAPTADGAI YYTPPSEDFS RPGRMWWSVP       360
     DGQDHFAKWR EVTTVYHEGV PGHHLQIGQT AYRSELLNRY QRQMLWCSGH GEGWALYSER       420
     LMDDLGYLAD PGDKLGMLDG QAFRATRVIV DIGVHLELEI PADNPFGFRP GQRWNAELAW       480
     EFLRAHCRIE EEMLKFELNR YLGWPGQAPS YKVGERIWLA AREDYKRRKG AEFNLKQFHT       540
     DALNLGALGL EPFQAALARL                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page