(data stored in SCRATCH zone)

EMBL: CP001778.PE235

CP001778.PE235       Location/Qualifiers
FT   CDS             254995..256989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0239"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; DEAD-like helicase; KEGG:
FT                   mxa:MXAN_6717 putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39958"
FT                   /db_xref="GOA:D3Q2Y8"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Y8"
FT                   /inference="protein motif:SMART:SM00491"
FT                   /protein_id="ADD39958.1"
FT                   /translation="MSKPTVAQLLDAAVAAVPGGEIRPGQQAMATAIAESMESGTHLMV
FT                   QAGTGTGKSLAYLAPALLSPRPVVISTATLALQSQLIATDLPRLSEAVEPVLGRKPRYA
FT                   VFKGRHHYLCAAKIGADATDEEDTLFSDTEESGWVGQRSRLGKDIGRLTDWANDTDTGD
FT                   RDDLDPGVSDAAWRQMSTSARDCVGAANCRWGGECFAEAARNRAREADIIITNHALLSI
FT                   DIMHNRTVLPEHDLLIVDEAHELADRTTSAARAELSANSVDRLGRRASGVCGKEIAAQL
FT                   TEIADQLGVVITECPNTRLEELPTALTEVLTLLDGACGTAIGEIGNVKPDSPEYMSRTQ
FT                   LKSWLTEARETAQRCLAGGRQDVRWCEGDGRGRSLIVAPLSVAGLLGEELFAERTVIAT
FT                   SATLTLGGSFDTAATSLGLKKENEVTEADKPSGTNTGPMWRSMDVGSPFEYRKQGILYV
FT                   AAHLPRPTASGLSDAAADELIRLVTALDGRALGLFSSKRAATTAAEVLREKTDLPILLQ
FT                   GDETLPLLVKKFKADARACLLGVMSLWQGVDVPGDACQLVIVDRLPFPRPDEPLSAARS
FT                   AAADEAGGSGFASVSVPHAAIRLAQGVGRLIRTGGDRGVAAVLDPRLHTARSYGPYLRK
FT                   SLPPLWYTTDSDKVQGALRRLAATPADLR"
     MSKPTVAQLL DAAVAAVPGG EIRPGQQAMA TAIAESMESG THLMVQAGTG TGKSLAYLAP        60
     ALLSPRPVVI STATLALQSQ LIATDLPRLS EAVEPVLGRK PRYAVFKGRH HYLCAAKIGA       120
     DATDEEDTLF SDTEESGWVG QRSRLGKDIG RLTDWANDTD TGDRDDLDPG VSDAAWRQMS       180
     TSARDCVGAA NCRWGGECFA EAARNRAREA DIIITNHALL SIDIMHNRTV LPEHDLLIVD       240
     EAHELADRTT SAARAELSAN SVDRLGRRAS GVCGKEIAAQ LTEIADQLGV VITECPNTRL       300
     EELPTALTEV LTLLDGACGT AIGEIGNVKP DSPEYMSRTQ LKSWLTEARE TAQRCLAGGR       360
     QDVRWCEGDG RGRSLIVAPL SVAGLLGEEL FAERTVIATS ATLTLGGSFD TAATSLGLKK       420
     ENEVTEADKP SGTNTGPMWR SMDVGSPFEY RKQGILYVAA HLPRPTASGL SDAAADELIR       480
     LVTALDGRAL GLFSSKRAAT TAAEVLREKT DLPILLQGDE TLPLLVKKFK ADARACLLGV       540
     MSLWQGVDVP GDACQLVIVD RLPFPRPDEP LSAARSAAAD EAGGSGFASV SVPHAAIRLA       600
     QGVGRLIRTG GDRGVAAVLD PRLHTARSYG PYLRKSLPPL WYTTDSDKVQ GALRRLAATP       660
     ADLR                                                                    664
//

If you have problems or comments...

PBIL Back to PBIL home page