(data stored in SCRATCH zone)

EMBL: CP001778.PE238

CP001778.PE238       Location/Qualifiers
FT   CDS             259511..260482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0243"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: bpt:Bpet2252
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39961"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q2Z1"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADD39961.1"
FT                   /translation="MTTPRSGAAKARRLVSVAVGIALILGFTAVPAEADPSVKELEKKI
FT                   EKRAEELEGTIEDYNAAREDLDKTKKKIKKLDKKLAPYEKELDKLYDKAEPIVMAAYQG
FT                   QGLTGPTAMLNSDSPEAFADKISALDGLSAGDAGLIGKVAKKARAYKSKKTDLEELKDE
FT                   QDKKESDLSKAKKKIEKEIEDLQGDRKTTIKNETGADYVPDYVPGKRGEVVRHAMAQVD
FT                   KPYVWAAAGPDGYDCSGLILDAYRQIGISLPHNAARQYGQATHIGKGDLQPGDPVFSNG
FT                   LKHVTMYIGDGYVVHAPTFGQPVQVAKMDTAASPYYGAGTFL"
     MTTPRSGAAK ARRLVSVAVG IALILGFTAV PAEADPSVKE LEKKIEKRAE ELEGTIEDYN        60
     AAREDLDKTK KKIKKLDKKL APYEKELDKL YDKAEPIVMA AYQGQGLTGP TAMLNSDSPE       120
     AFADKISALD GLSAGDAGLI GKVAKKARAY KSKKTDLEEL KDEQDKKESD LSKAKKKIEK       180
     EIEDLQGDRK TTIKNETGAD YVPDYVPGKR GEVVRHAMAQ VDKPYVWAAA GPDGYDCSGL       240
     ILDAYRQIGI SLPHNAARQY GQATHIGKGD LQPGDPVFSN GLKHVTMYIG DGYVVHAPTF       300
     GQPVQVAKMD TAASPYYGAG TFL                                               323
//

If you have problems or comments...

PBIL Back to PBIL home page