(data stored in SCRATCH zone)

EMBL: CP001778.PE248

CP001778.PE248       Location/Qualifiers
FT   CDS             complement(267087..267701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0253"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: mms:mma_2815
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39971"
FT                   /db_xref="GOA:D3Q301"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q301"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADD39971.1"
FT                   /translation="MTPEVLTADNTAVLLVDHQIGLFTGVRDLGTDELAHNVAALAASA
FT                   TRLGLPVIATTTAADSMWGPLVPELVAALPHGHPVIDRGTVNAWDDERVRRAVEATGRR
FT                   NLVIAGVSLEVCAALPALAAVRNGLNAYVAVDASGTFSRTKRETGLLRLAQAGVVVADY
FT                   SALMVEILADNAAPHAGEVYGALDMPFAKLVGGLSAAIRSR"
     MTPEVLTADN TAVLLVDHQI GLFTGVRDLG TDELAHNVAA LAASATRLGL PVIATTTAAD        60
     SMWGPLVPEL VAALPHGHPV IDRGTVNAWD DERVRRAVEA TGRRNLVIAG VSLEVCAALP       120
     ALAAVRNGLN AYVAVDASGT FSRTKRETGL LRLAQAGVVV ADYSALMVEI LADNAAPHAG       180
     EVYGALDMPF AKLVGGLSAA IRSR                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page