(data stored in SCRATCH zone)

EMBL: CP001778.PE26

CP001778.PE26        Location/Qualifiers
FT   CDS             33595..35343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0027"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   vei:Veis_2018 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39749"
FT                   /db_xref="GOA:D3PTZ1"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADD39749.1"
FT                   /translation="MRADRTQSRYQAGALSPQRRAADLERMRTEHFDVLIIGGGVTGTG
FT                   AALDAASRGLKVALVEARDYSSGTSSRSSKLIHGGLRYLEQFEFGLVHEALTERGLLCH
FT                   RIAPHLVHPLAFLAPLSGRVWQRAYYGAGLALYDTLATALGGSSGRLPLHRHLSKRRTR
FT                   RLFPGLSSQKVLGSIKYFDAQTDDARFVTTMARTAASYGAAMATSARVVGFQRDARQVT
FT                   GARVADMETGDEFDVSATTIIAATGVWSNDLSGMLGSQVGLRVRASKGIHLVVKRSAIN
FT                   GDSAIILRTSSSVLFILPWGGHWVIGTTDTDWSLDRDHPAASAIDVAYLLELANGILER
FT                   PLSIDDVEGVYAGLRPLLSGEDEDTSSLSREHAVVEPMLGLLLVAGGKFTTYRIMAKDA
FT                   VDRAARRLHGVPASRTADIPLLGADGYRQAWAGRERLASRTGVHPGIVEHLLRRYGTLA
FT                   QEVLALIAENPKFGEPLAGAPEYLAAEVVYAVRNEGALHTDDVLTRRTRVSIETSHRGE
FT                   KSVEHVVALMGDELGWDKATRDNEISHYLSRVAAERDSQRQPDDATADAARLGAEDVRV
FT                   GLNTPV"
     MRADRTQSRY QAGALSPQRR AADLERMRTE HFDVLIIGGG VTGTGAALDA ASRGLKVALV        60
     EARDYSSGTS SRSSKLIHGG LRYLEQFEFG LVHEALTERG LLCHRIAPHL VHPLAFLAPL       120
     SGRVWQRAYY GAGLALYDTL ATALGGSSGR LPLHRHLSKR RTRRLFPGLS SQKVLGSIKY       180
     FDAQTDDARF VTTMARTAAS YGAAMATSAR VVGFQRDARQ VTGARVADME TGDEFDVSAT       240
     TIIAATGVWS NDLSGMLGSQ VGLRVRASKG IHLVVKRSAI NGDSAIILRT SSSVLFILPW       300
     GGHWVIGTTD TDWSLDRDHP AASAIDVAYL LELANGILER PLSIDDVEGV YAGLRPLLSG       360
     EDEDTSSLSR EHAVVEPMLG LLLVAGGKFT TYRIMAKDAV DRAARRLHGV PASRTADIPL       420
     LGADGYRQAW AGRERLASRT GVHPGIVEHL LRRYGTLAQE VLALIAENPK FGEPLAGAPE       480
     YLAAEVVYAV RNEGALHTDD VLTRRTRVSI ETSHRGEKSV EHVVALMGDE LGWDKATRDN       540
     EISHYLSRVA AERDSQRQPD DATADAARLG AEDVRVGLNT PV                          582
//

If you have problems or comments...

PBIL Back to PBIL home page