(data stored in SCRATCH zone)

EMBL: CP001778.PE264

CP001778.PE264       Location/Qualifiers
FT   CDS             complement(284506..285435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0269"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   cak:Caul_4640 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39987"
FT                   /db_xref="GOA:D3Q317"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q317"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADD39987.1"
FT                   /translation="MHHPRNPTVPPGVEYHRVLAGDKRRVGRGILAILLLVVGGAVFAF
FT                   AASQAAGYLDARLGRTNPARGGSDYTPIFHAATMFSLALLIPWSMLIQRWLYGVRGASL
FT                   HSVLSRFRLDVFGRALLIIGPIWLIPTVVLNVAMPAERTHWSNADLVAVFATTLLLTPL
FT                   QTAGEEYGVRGLVFRVAGSWSRGPRLGLVLGVLVSSLAFTAVHGSSDPWIILWYFTLAV
FT                   SLAVITWRTGGIETAIVIHALLNTLTFLLAIVVHADLTNTDRSAGAGSVALLVPSVVVA
FT                   GIAAVVWLWTRRTGPVLTPSRASTLTNK"
     MHHPRNPTVP PGVEYHRVLA GDKRRVGRGI LAILLLVVGG AVFAFAASQA AGYLDARLGR        60
     TNPARGGSDY TPIFHAATMF SLALLIPWSM LIQRWLYGVR GASLHSVLSR FRLDVFGRAL       120
     LIIGPIWLIP TVVLNVAMPA ERTHWSNADL VAVFATTLLL TPLQTAGEEY GVRGLVFRVA       180
     GSWSRGPRLG LVLGVLVSSL AFTAVHGSSD PWIILWYFTL AVSLAVITWR TGGIETAIVI       240
     HALLNTLTFL LAIVVHADLT NTDRSAGAGS VALLVPSVVV AGIAAVVWLW TRRTGPVLTP       300
     SRASTLTNK                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page