(data stored in SCRATCH zone)

EMBL: CP001778.PE265

CP001778.PE265       Location/Qualifiers
FT   CDS             285564..286178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0270"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_2620
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39988"
FT                   /db_xref="GOA:D3Q318"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q318"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD39988.1"
FT                   /translation="MAKRDPEGLSTRDKILLAAITMFGEDQSASLSVRAVAARAQVSTG
FT                   SLRHHFPTQRALQDAVLATIYDHVSADDRIHDRSSPARDRLLDCLRQVLAAAKPGEQAR
FT                   KAWGEIFHRFVEPDPTDEIRASYLAIEQEVQRRVEYWLTVLGNEGALPDGDNTRRARFL
FT                   VTVLNGLSIERALPAQTSILNSETETLRTAVDCVFAPLSAE"
     MAKRDPEGLS TRDKILLAAI TMFGEDQSAS LSVRAVAARA QVSTGSLRHH FPTQRALQDA        60
     VLATIYDHVS ADDRIHDRSS PARDRLLDCL RQVLAAAKPG EQARKAWGEI FHRFVEPDPT       120
     DEIRASYLAI EQEVQRRVEY WLTVLGNEGA LPDGDNTRRA RFLVTVLNGL SIERALPAQT       180
     SILNSETETL RTAVDCVFAP LSAE                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page