(data stored in SCRATCH zone)

EMBL: CP001778.PE271

CP001778.PE271       Location/Qualifiers
FT   CDS             290313..290843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0276"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   afw:Anae109_1188 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39994"
FT                   /db_xref="GOA:D3Q324"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q324"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADD39994.1"
FT                   /translation="MSTIEAALTAGTGQAPSDSRLTLSSIMSPQDTNLMGTVHGGVILK
FT                   LIDSVAGVVAARHSQGPAVTASMDETVFLAPVRVGDVAHVDARITWAGRTSMEVAVTVT
FT                   ADRWNETVPATTVATAHLVMVAVDDNGNPRPVPPVVPVSQEDRLAWREAEIRRTHRLAL
FT                   RASLSSKKDDNAA"
     MSTIEAALTA GTGQAPSDSR LTLSSIMSPQ DTNLMGTVHG GVILKLIDSV AGVVAARHSQ        60
     GPAVTASMDE TVFLAPVRVG DVAHVDARIT WAGRTSMEVA VTVTADRWNE TVPATTVATA       120
     HLVMVAVDDN GNPRPVPPVV PVSQEDRLAW REAEIRRTHR LALRASLSSK KDDNAA           176
//

If you have problems or comments...

PBIL Back to PBIL home page