(data stored in SCRATCH zone)

EMBL: CP001778.PE273

CP001778.PE273       Location/Qualifiers
FT   CDS             complement(291464..292135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0278"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: MOT37; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39996"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q326"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39996.1"
FT                   /translation="MDKQLARAIRVAVRHTQTPTEDELRTIEKLHVLRARDLSGLESCT
FT                   SMRHLVLSGCDPVSLQSLTGMRDLEVATVEYCGLRRLDGVEELSDSFLYLKAPNNSIED
FT                   LSPLLDCPGLNRLEVQGNPLSEHSYLEILPRLRARGVQVFASGMREWRLTRRLHEIGLP
FT                   FSYYHSDEGHQLCRPGLSYTDFPATGHPIIDPDDLERLIDAEPTRIHELFAQEELMFAL
FT                   P"
     MDKQLARAIR VAVRHTQTPT EDELRTIEKL HVLRARDLSG LESCTSMRHL VLSGCDPVSL        60
     QSLTGMRDLE VATVEYCGLR RLDGVEELSD SFLYLKAPNN SIEDLSPLLD CPGLNRLEVQ       120
     GNPLSEHSYL EILPRLRARG VQVFASGMRE WRLTRRLHEI GLPFSYYHSD EGHQLCRPGL       180
     SYTDFPATGH PIIDPDDLER LIDAEPTRIH ELFAQEELMF ALP                         223
//

If you have problems or comments...

PBIL Back to PBIL home page