(data stored in SCRATCH zone)

EMBL: CP001778.PE280

CP001778.PE280       Location/Qualifiers
FT   CDS             297517..298641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0285"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; creatinase; KEGG:
FT                   sit:TM1040_2712 peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40003"
FT                   /db_xref="GOA:D3Q333"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q333"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADD40003.1"
FT                   /translation="MTIFTKVELTDRLAKARSATEASGIDAVLISPGADLHYLTGYDAK
FT                   PLERLTCLVLRPGAEPLLVVPVLERAAAQASPAGDLGLELVSWHETEDPYALVAALLPP
FT                   GTRRIAYDNHMWAEKLLAFRSALPGTEQELAGEILRELRMRKSGNEIEALRRAGAAIDR
FT                   VHARMAEWLRPGRTEREVGADIAEAIAAEGHATVDFVIVGSGPNGASPHHDLSDRVIQP
FT                   GDPVVVDIGGTTADGYCSDSTRTYVAGGEAPEEFAAYYEVLLRAQIAACEHVRPGVTAA
FT                   SVDAAARDVIAAAGYGERFIHRTGHGIGMQGHEDPYIVAGNERVLEPGMAFSIEPGIYV
FT                   DGAHGARIEDIVVVTDDGVERLNLTPRELVVIDA"
     MTIFTKVELT DRLAKARSAT EASGIDAVLI SPGADLHYLT GYDAKPLERL TCLVLRPGAE        60
     PLLVVPVLER AAAQASPAGD LGLELVSWHE TEDPYALVAA LLPPGTRRIA YDNHMWAEKL       120
     LAFRSALPGT EQELAGEILR ELRMRKSGNE IEALRRAGAA IDRVHARMAE WLRPGRTERE       180
     VGADIAEAIA AEGHATVDFV IVGSGPNGAS PHHDLSDRVI QPGDPVVVDI GGTTADGYCS       240
     DSTRTYVAGG EAPEEFAAYY EVLLRAQIAA CEHVRPGVTA ASVDAAARDV IAAAGYGERF       300
     IHRTGHGIGM QGHEDPYIVA GNERVLEPGM AFSIEPGIYV DGAHGARIED IVVVTDDGVE       360
     RLNLTPRELV VIDA                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page