(data stored in SCRATCH zone)

EMBL: CP001778.PE282

CP001778.PE282       Location/Qualifiers
FT   CDS             299266..300444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0287"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /EC_number="1.13.11.27"
FT                   /note="KEGG: 4-hydroxyphenylpyruvate dioxygenase ; K00457
FT                   4-hydroxyphenylpyruvate dioxygenase; TIGRFAM:
FT                   4-hydroxyphenylpyruvate dioxygenase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40005"
FT                   /db_xref="GOA:D3Q335"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q335"
FT                   /inference="protein motif:TFAM:TIGR01263"
FT                   /protein_id="ADD40005.1"
FT                   /translation="MVDTINEAQLVGAVEHDINADDFPIKGWDHIRFYVGNAKQAAHYY
FT                   STAFGMTLEAYRGPEQGFREHAEYMLRSGGVRFVLAGGITADSAATKHYAAHGDGVIEV
FT                   ALEVPNVDDNYAFAIKQGAVGVEEPHDLTDEYGTVRVAAIATYGETRHVLVDRSRYNGP
FT                   FLPGYVAAKPIVDRTAAIKDGREPKRFFQALDHVVGNVEEGKMLDWVTFYQKVMGFTNI
FT                   VEFVDDDIATEYSALMSKVVANGTRKVKFPINEPAEGRKKSQIDEYLEFYGGPGVQHMA
FT                   LATNDILASVDAMRANGVEFLDAPDSYYDDPEMRERIGTVRVPIEELKKRSILVDRDED
FT                   GYLLQIFTKPQQDRPSVFYELIERHGSLSFGKGNFKALFEAIEKEQAKRGNL"
     MVDTINEAQL VGAVEHDINA DDFPIKGWDH IRFYVGNAKQ AAHYYSTAFG MTLEAYRGPE        60
     QGFREHAEYM LRSGGVRFVL AGGITADSAA TKHYAAHGDG VIEVALEVPN VDDNYAFAIK       120
     QGAVGVEEPH DLTDEYGTVR VAAIATYGET RHVLVDRSRY NGPFLPGYVA AKPIVDRTAA       180
     IKDGREPKRF FQALDHVVGN VEEGKMLDWV TFYQKVMGFT NIVEFVDDDI ATEYSALMSK       240
     VVANGTRKVK FPINEPAEGR KKSQIDEYLE FYGGPGVQHM ALATNDILAS VDAMRANGVE       300
     FLDAPDSYYD DPEMRERIGT VRVPIEELKK RSILVDRDED GYLLQIFTKP QQDRPSVFYE       360
     LIERHGSLSF GKGNFKALFE AIEKEQAKRG NL                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page