(data stored in SCRATCH zone)

EMBL: CP001778.PE287

CP001778.PE287       Location/Qualifiers
FT   CDS             304578..305153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40010"
FT                   /db_xref="GOA:D3Q340"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q340"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40010.1"
FT                   /translation="MTNPTIATPTRPWWQWLLRRWPTALALLLSALTLGGSGTDEGVRS
FT                   FAHVLGLLPLLYLVVAKLEKRRATWPLLVTGLAAVIGLRVLDLIPLAAVWWAIALVVLV
FT                   WGAFDGHLAKSGTLRVQALGMLIFGGLGLLGLIVDPELARYLIAAGWFFHGVWDFVHLK
FT                   LDRVVARSFAEWCGVVDIVVAAELLLYL"
     MTNPTIATPT RPWWQWLLRR WPTALALLLS ALTLGGSGTD EGVRSFAHVL GLLPLLYLVV        60
     AKLEKRRATW PLLVTGLAAV IGLRVLDLIP LAAVWWAIAL VVLVWGAFDG HLAKSGTLRV       120
     QALGMLIFGG LGLLGLIVDP ELARYLIAAG WFFHGVWDFV HLKLDRVVAR SFAEWCGVVD       180
     IVVAAELLLY L                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page