(data stored in SCRATCH zone)

EMBL: CP001778.PE33

CP001778.PE33        Location/Qualifiers
FT   CDS             complement(43979..44374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39756"
FT                   /db_xref="UniProtKB/TrEMBL:D3PTZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39756.1"
FT                   /translation="MTSEIRLDKRALREFISLMDQTAEEMADIQDGTTPRYARSGGGGE
FT                   AAYRNGVKVTVGSVDFAHPGRVAGELMADRIAETLEFVRSLEEGSRALARIVRSVLDDM
FT                   GARDSIAASDLARINNSMEGRSRGDQL"
     MTSEIRLDKR ALREFISLMD QTAEEMADIQ DGTTPRYARS GGGGEAAYRN GVKVTVGSVD        60
     FAHPGRVAGE LMADRIAETL EFVRSLEEGS RALARIVRSV LDDMGARDSI AASDLARINN       120
     SMEGRSRGDQ L                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page