(data stored in SCRATCH zone)

EMBL: CP001778.PE347

CP001778.PE347       Location/Qualifiers
FT   CDS             complement(356321..358897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0352"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: acp:A2cp1_2419
FT                   2-alkenal reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40070"
FT                   /db_xref="GOA:D3Q4B0"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4B0"
FT                   /inference="protein motif:PFAM:PF00012"
FT                   /protein_id="ADD40070.1"
FT                   /translation="MPTSPVSPAGAPATGATPPADGYVLGVDLGTSHTVAVIRWPDGRA
FT                   RPLLVDGAPVMPSAVYLDEAGHIHVGRDAQRLAQTDPTQFEPNPKHRIGETSVLLGDRE
FT                   VPVTALLSAILREVAAKAVEAVGHLPPAVLTCPAKWGPQFRGVLENAAAQAGFPPVRLV
FT                   PEPVAAAHYFAEVMRRPIPMGRSVAVFDFGGGTLDIAVVRHQEDGGYAVQADGGLEDLG
FT                   GLDVDAALVDYVGRTINATVPQIWQQLTQPQNGNDRRNRRLFWDDVRGAKEMLSRTTVA
FT                   PIPVPGVESSLHLTREELEKLAGPLLERAVAETQRVIAATGQSPDQLAGLFLVGGASRI
FT                   PLVGRLLHSQLGIAPTVLEQPELPVAEGSLAAGFPAAAPVSPATTVPGEPYTPPPGQSP
FT                   PEGFLAPTPPAKPWYRKKTGWIAAGVGVVVLAVLGWLVLRDPYPQQDMHDLTDVGTAKY
FT                   PKGVGPDAVTFVSGTVDGPAAYMAAEASEDYKLHLTSVDLETGKEKWTSGLEAADDTSG
FT                   TWTVSARNGVVYAASKGYEESKLYVLNPDSGKETTIDVGVEDEFMVLGDKLIRMDKDKD
FT                   TVIGYNGSGKEQWTVKAGLDISSFGDDDTWSYYENPIGGDAIDDSHLMYVRDDEGKVNV
FT                   IDVDEGKSVTDGKVGDTDSAFIAYAGKLLVTTGASSYNLTAYDLEDNLKQLGSWKQPKG
FT                   LGAPVAISVCGETRVCVGQSQDNTDTPGSLSVFDLDDSDGVSLWQSPKETRVSGVQVAG
FT                   ETLALDTVDSEEVTRTQLYDSDFEKIGKAQEGHYLRIDSGSFLQYPWGGDDTMTSGEAT
FT                   EIVGLGARDGERQSLGSKEVQSGCAASGEQLVCPTADGYSTWRFRN"
     MPTSPVSPAG APATGATPPA DGYVLGVDLG TSHTVAVIRW PDGRARPLLV DGAPVMPSAV        60
     YLDEAGHIHV GRDAQRLAQT DPTQFEPNPK HRIGETSVLL GDREVPVTAL LSAILREVAA       120
     KAVEAVGHLP PAVLTCPAKW GPQFRGVLEN AAAQAGFPPV RLVPEPVAAA HYFAEVMRRP       180
     IPMGRSVAVF DFGGGTLDIA VVRHQEDGGY AVQADGGLED LGGLDVDAAL VDYVGRTINA       240
     TVPQIWQQLT QPQNGNDRRN RRLFWDDVRG AKEMLSRTTV APIPVPGVES SLHLTREELE       300
     KLAGPLLERA VAETQRVIAA TGQSPDQLAG LFLVGGASRI PLVGRLLHSQ LGIAPTVLEQ       360
     PELPVAEGSL AAGFPAAAPV SPATTVPGEP YTPPPGQSPP EGFLAPTPPA KPWYRKKTGW       420
     IAAGVGVVVL AVLGWLVLRD PYPQQDMHDL TDVGTAKYPK GVGPDAVTFV SGTVDGPAAY       480
     MAAEASEDYK LHLTSVDLET GKEKWTSGLE AADDTSGTWT VSARNGVVYA ASKGYEESKL       540
     YVLNPDSGKE TTIDVGVEDE FMVLGDKLIR MDKDKDTVIG YNGSGKEQWT VKAGLDISSF       600
     GDDDTWSYYE NPIGGDAIDD SHLMYVRDDE GKVNVIDVDE GKSVTDGKVG DTDSAFIAYA       660
     GKLLVTTGAS SYNLTAYDLE DNLKQLGSWK QPKGLGAPVA ISVCGETRVC VGQSQDNTDT       720
     PGSLSVFDLD DSDGVSLWQS PKETRVSGVQ VAGETLALDT VDSEEVTRTQ LYDSDFEKIG       780
     KAQEGHYLRI DSGSFLQYPW GGDDTMTSGE ATEIVGLGAR DGERQSLGSK EVQSGCAASG       840
     EQLVCPTADG YSTWRFRN                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page