(data stored in SCRATCH zone)

EMBL: CP001778.PE357

CP001778.PE357       Location/Qualifiers
FT   CDS             368833..369198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sat:SYN_02114 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40080"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40080.1"
FT                   /translation="MAEVVYDKKDQLKQIEELLLNGEQVIAVYDAIGVGTGFIGLTDKR
FT                   VILKNKSFVGKKVALTSIPYAKISAVSLTSNKSFAGQWFSSGEMAIHAGKEIHEIEFRG
FT                   DRKTHHVHQVIMHYITR"
     MAEVVYDKKD QLKQIEELLL NGEQVIAVYD AIGVGTGFIG LTDKRVILKN KSFVGKKVAL        60
     TSIPYAKISA VSLTSNKSFA GQWFSSGEMA IHAGKEIHEI EFRGDRKTHH VHQVIMHYIT       120
     R                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page