(data stored in SCRATCH zone)

EMBL: CP001778.PE359

CP001778.PE359       Location/Qualifiers
FT   CDS             complement(370887..371783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0365"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: dvm:DvMF_1194 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40082"
FT                   /db_xref="GOA:D3Q4C2"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4C2"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADD40082.1"
FT                   /translation="MTAEQNADATEAKESGPPEAETPDSGAADKDTAEESTDLATQLSE
FT                   RTADLQRITAEYHNYRKRVERDKSLAAEQTTATVVAGLLPVLDDIDRAREHGDLEGPFA
FT                   TVSEQLLNALIKLGLEVFGEKGDPFDPAVHEAVAHMVSPEVTETSCIDVMRRGYRLGER
FT                   LLRPAMVAVAEPAEAETAETGKTEAVAEDAELSAETEEAVEAETEAKAEAEAEAAVEAE
FT                   VEVEELAETKDEDATPNLDADVPSDEEQVKAEQVEDAVAEAAESDAEAGSEAVDEEKPE
FT                   SEKDKSAPDDTKKTENE"
     MTAEQNADAT EAKESGPPEA ETPDSGAADK DTAEESTDLA TQLSERTADL QRITAEYHNY        60
     RKRVERDKSL AAEQTTATVV AGLLPVLDDI DRAREHGDLE GPFATVSEQL LNALIKLGLE       120
     VFGEKGDPFD PAVHEAVAHM VSPEVTETSC IDVMRRGYRL GERLLRPAMV AVAEPAEAET       180
     AETGKTEAVA EDAELSAETE EAVEAETEAK AEAEAEAAVE AEVEVEELAE TKDEDATPNL       240
     DADVPSDEEQ VKAEQVEDAV AEAAESDAEA GSEAVDEEKP ESEKDKSAPD DTKKTENE         298
//

If you have problems or comments...

PBIL Back to PBIL home page