(data stored in SCRATCH zone)

EMBL: CP001778.PE367

CP001778.PE367       Location/Qualifiers
FT   CDS             complement(379925..380515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0373"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: dal:Dalk_5036 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40090"
FT                   /db_xref="GOA:D3Q4D0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D0"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADD40090.1"
FT                   /translation="MKGQGVSELAGEAGYLLEIGLLKRTRRTGWWIAGIRDPESIAEHS
FT                   WRTAITGMIIASHEGADPARTSMLCSLHDTPETRIGDIPKIGKHYLKATAPDTIAADQT
FT                   AKCSDQAGQVIRDAIAEFEAGQTPEALCAKDADKLECLIQAVEYQHQGVSTVTRWIESS
FT                   LAALKTDTARGLADEILKANPLAWEQTRRPSAT"
     MKGQGVSELA GEAGYLLEIG LLKRTRRTGW WIAGIRDPES IAEHSWRTAI TGMIIASHEG        60
     ADPARTSMLC SLHDTPETRI GDIPKIGKHY LKATAPDTIA ADQTAKCSDQ AGQVIRDAIA       120
     EFEAGQTPEA LCAKDADKLE CLIQAVEYQH QGVSTVTRWI ESSLAALKTD TARGLADEIL       180
     KANPLAWEQT RRPSAT                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page