(data stored in SCRATCH zone)

EMBL: CP001778.PE370

CP001778.PE370       Location/Qualifiers
FT   CDS             381915..382148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40093"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40093.1"
FT                   /translation="MSFTDSETLARNANYTMKCHSKVDTEGYCTGCRNYHGKLERPGPE
FT                   GCYFYRLAFEVYRKHALSHSIQGDDNVYIRHT"
     MSFTDSETLA RNANYTMKCH SKVDTEGYCT GCRNYHGKLE RPGPEGCYFY RLAFEVYRKH        60
     ALSHSIQGDD NVYIRHT                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page