(data stored in SCRATCH zone)

EMBL: CP001778.PE372

CP001778.PE372       Location/Qualifiers
FT   CDS             382571..383392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40095"
FT                   /db_xref="InterPro:IPR032724"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4D5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40095.1"
FT                   /translation="MGSVAELIAAVRAALSTLAEGRTLTNQARATLEEATGRMEGIARG
FT                   SASYQLRNSLDALAAAVAGLDRMAEAENAAQEHVIAYLASIGADGRAPEPEPEKTSPKK
FT                   PTASSDLKAIGERLGLKPCEGLLGTLPAMKPNSGQRTRGRWHKHPDRELTSGANDRDWE
FT                   HVKDFWHHNIWSGTAEDTEPRWLAHLELKFAMTMRRTRTKSEPVDQVHEEITINHPDGP
FT                   CPQCQLLLPYFLEEGSSLTIHWPAGSATYIGRPYFDRPLRDVKPYINEEQQ"
     MGSVAELIAA VRAALSTLAE GRTLTNQARA TLEEATGRME GIARGSASYQ LRNSLDALAA        60
     AVAGLDRMAE AENAAQEHVI AYLASIGADG RAPEPEPEKT SPKKPTASSD LKAIGERLGL       120
     KPCEGLLGTL PAMKPNSGQR TRGRWHKHPD RELTSGANDR DWEHVKDFWH HNIWSGTAED       180
     TEPRWLAHLE LKFAMTMRRT RTKSEPVDQV HEEITINHPD GPCPQCQLLL PYFLEEGSSL       240
     TIHWPAGSAT YIGRPYFDRP LRDVKPYINE EQQ                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page