(data stored in SCRATCH zone)

EMBL: CP001778.PE381

CP001778.PE381       Location/Qualifiers
FT   CDS             complement(391337..391948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0387"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mlo:mlr8191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40104"
FT                   /db_xref="GOA:D3Q4E4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4E4"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADD40104.1"
FT                   /translation="MSIEFLLTTLVVVATPGTGVVYTLAAGLSRGAKASLIAAVGCTLG
FT                   IVPHMIAAVTGLAALLHASATAFEIIKYAGVAYLLYMAWATIRDKGALTVEADTAPQST
FT                   LRVIGSGVLVNILNPKLTIFFFAFLPQFVPAGAPNALPRMLGLSAVFMLATLAVFALYG
FT                   VFAAAVREHVISRVRVMTWLRRTFAASFVVLAGRLALTER"
     MSIEFLLTTL VVVATPGTGV VYTLAAGLSR GAKASLIAAV GCTLGIVPHM IAAVTGLAAL        60
     LHASATAFEI IKYAGVAYLL YMAWATIRDK GALTVEADTA PQSTLRVIGS GVLVNILNPK       120
     LTIFFFAFLP QFVPAGAPNA LPRMLGLSAV FMLATLAVFA LYGVFAAAVR EHVISRVRVM       180
     TWLRRTFAAS FVVLAGRLAL TER                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page