(data stored in SCRATCH zone)

EMBL: CP001778.PE394

CP001778.PE394       Location/Qualifiers
FT   CDS             405677..406606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0400"
FT                   /product="WD40 domain protein beta Propeller"
FT                   /note="PFAM: WD40 domain protein beta Propeller; KEGG:
FT                   scl:sce5991 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40117"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4F7"
FT                   /inference="protein motif:PFAM:PF07676"
FT                   /protein_id="ADD40117.1"
FT                   /translation="MRSRSPNVIRIARSTAGVALLLATATLGSCTDQAATVDESCDVND
FT                   RGHWAIAYTKQEDTAVKGVYWLVDGEHKPLNKDKDIQAQDPSLSPDGRKVLFEGFHGDG
FT                   GKYVNKKLIMNTDGSGLKIFGEGISTPVWSPNGKRLAYRDTDRNTIMVSNPDGTDEREI
FT                   AEDAASNPVWSADGEKLAWIPNGANAVRWAEPEGKKSGMAQMLGEQAITVAWQPDGESV
FT                   VVSLVKGDDAHLYRLNLSDNKEPELLAEDATAPFALPDGTIGARVDKRGDGDYNQYVSV
FT                   DPKTGKSEDLAKIPGQHPSVIACHGVKR"
     MRSRSPNVIR IARSTAGVAL LLATATLGSC TDQAATVDES CDVNDRGHWA IAYTKQEDTA        60
     VKGVYWLVDG EHKPLNKDKD IQAQDPSLSP DGRKVLFEGF HGDGGKYVNK KLIMNTDGSG       120
     LKIFGEGIST PVWSPNGKRL AYRDTDRNTI MVSNPDGTDE REIAEDAASN PVWSADGEKL       180
     AWIPNGANAV RWAEPEGKKS GMAQMLGEQA ITVAWQPDGE SVVVSLVKGD DAHLYRLNLS       240
     DNKEPELLAE DATAPFALPD GTIGARVDKR GDGDYNQYVS VDPKTGKSED LAKIPGQHPS       300
     VIACHGVKR                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page