(data stored in SCRATCH zone)

EMBL: CP001778.PE411

CP001778.PE411       Location/Qualifiers
FT   CDS             424539..425879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0417"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: scl:sce2422 putative metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40134"
FT                   /db_xref="GOA:D3Q4H4"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H4"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ADD40134.1"
FT                   /translation="MKKRFLLLAGVLAASVAAVGPAQAAEPDEPVTPQDAKYLLSLDSD
FT                   ATGANWSGTQTVTFRNKSDRTMDTLWIRLWGNGRGGCDDRAVSIEPRFGGELGAETVDC
FT                   TAVPIELTRPVPAGRTGMVSVDVDIAVPEETYRFGRAGDYRFIGNAIPVLAVHDGTGEL
FT                   PPFTSFGESFYTLESDFLVTLDHPNAVKVPATGRSIAEVKHGKNTTTVIKANNVRDFAW
FT                   AAGPFAKVDTVSATGAKLRTWYPGDIDKAKAEEVTGWVKEGMDTFDAAYGEYPYSEMDT
FT                   VIGDWEGFAGMEYPGFILTEPAKVPAVHEAGHQWFYGLVGNDQYNDPWLDESVTQYMTN
FT                   TITGVPGYCATAPFWFSDGMRIDAGMDYYNEHIEDEYAPAIYGDGACMLAELETTIGKP
FT                   AMDEALRTAVAEFSGGVITSDELRGIFAEVSGQDLSAFWERWRNTGA"
     MKKRFLLLAG VLAASVAAVG PAQAAEPDEP VTPQDAKYLL SLDSDATGAN WSGTQTVTFR        60
     NKSDRTMDTL WIRLWGNGRG GCDDRAVSIE PRFGGELGAE TVDCTAVPIE LTRPVPAGRT       120
     GMVSVDVDIA VPEETYRFGR AGDYRFIGNA IPVLAVHDGT GELPPFTSFG ESFYTLESDF       180
     LVTLDHPNAV KVPATGRSIA EVKHGKNTTT VIKANNVRDF AWAAGPFAKV DTVSATGAKL       240
     RTWYPGDIDK AKAEEVTGWV KEGMDTFDAA YGEYPYSEMD TVIGDWEGFA GMEYPGFILT       300
     EPAKVPAVHE AGHQWFYGLV GNDQYNDPWL DESVTQYMTN TITGVPGYCA TAPFWFSDGM       360
     RIDAGMDYYN EHIEDEYAPA IYGDGACMLA ELETTIGKPA MDEALRTAVA EFSGGVITSD       420
     ELRGIFAEVS GQDLSAFWER WRNTGA                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page