(data stored in SCRATCH zone)

EMBL: CP001778.PE413

CP001778.PE413       Location/Qualifiers
FT   CDS             426487..428211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0419"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; KEGG: oca:OCAR_7320 ABC transporter,
FT                   permease/ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40136"
FT                   /db_xref="GOA:D3Q4H6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4H6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD40136.1"
FT                   /translation="MSPLPPHADPGTPDARSPGRYLWWLLWKQPSRVFLGAFWGIVSSV
FT                   GIASLPFFMGKAVDEGLRARALEPLAWWTAGLILVGGVNAAANILRHRTMTHVRMDASL
FT                   RTVQVVNRHAARLGSVLARRVSTGEIVAIGASDAKQVSHAMTSAGPGVGSVVACVLIAV
FT                   MVLSISPLLGALVLVGVPAIVLSIGPLTKRLQRTESTYREHTGVLTARAGDIAAGLRVL
FT                   RGIGGESLFASRYRRRSGELLSEGYRVGAVASWIHALGSGLPGLFLALVTWLAARLVAA
FT                   GQISFGDMVAVYGYAAALVLPVAFFIEAIFDITRGRVAARRIIGVLNLEPAVTDPAEAV
FT                   AGPVGPAELYDPESGLRVPARRLAAVATADAESAALIVERIARYTDSDAAYGGVPLSDM
FT                   ALAEVRRRILLSGNDSHLFAGTLRDMVSPSGDIDDATIGTAVRQAAATDIVEALPDGLD
FT                   TEIDAQARTLSGGQRQRVRLVRALLAEPEVLILPEPTSAVDAHSEAAIAEGLREHRRDR
FT                   TTLVLSTSPLVLDRCDEVAFVEDGKVTATGTHARLLNTEPGYRALVLRGAEEEGETP"
     MSPLPPHADP GTPDARSPGR YLWWLLWKQP SRVFLGAFWG IVSSVGIASL PFFMGKAVDE        60
     GLRARALEPL AWWTAGLILV GGVNAAANIL RHRTMTHVRM DASLRTVQVV NRHAARLGSV       120
     LARRVSTGEI VAIGASDAKQ VSHAMTSAGP GVGSVVACVL IAVMVLSISP LLGALVLVGV       180
     PAIVLSIGPL TKRLQRTEST YREHTGVLTA RAGDIAAGLR VLRGIGGESL FASRYRRRSG       240
     ELLSEGYRVG AVASWIHALG SGLPGLFLAL VTWLAARLVA AGQISFGDMV AVYGYAAALV       300
     LPVAFFIEAI FDITRGRVAA RRIIGVLNLE PAVTDPAEAV AGPVGPAELY DPESGLRVPA       360
     RRLAAVATAD AESAALIVER IARYTDSDAA YGGVPLSDMA LAEVRRRILL SGNDSHLFAG       420
     TLRDMVSPSG DIDDATIGTA VRQAAATDIV EALPDGLDTE IDAQARTLSG GQRQRVRLVR       480
     ALLAEPEVLI LPEPTSAVDA HSEAAIAEGL REHRRDRTTL VLSTSPLVLD RCDEVAFVED       540
     GKVTATGTHA RLLNTEPGYR ALVLRGAEEE GETP                                   574
//

If you have problems or comments...

PBIL Back to PBIL home page