(data stored in SCRATCH zone)

EMBL: CP001778.PE457

CP001778.PE457       Location/Qualifiers
FT   CDS             483127..483456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40180"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40180.1"
FT                   /translation="MGHEVAAILKARGRPLVDANCLAQAARAHLLGERAERVLEPAERA
FT                   LELIGGLRARVEMELVATLGEALARLGHRERAESCLRRALELSEVHEDAAEGERVWGAL
FT                   SRLRG"
     MGHEVAAILK ARGRPLVDAN CLAQAARAHL LGERAERVLE PAERALELIG GLRARVEMEL        60
     VATLGEALAR LGHRERAESC LRRALELSEV HEDAAEGERV WGALSRLRG                   109
//

If you have problems or comments...

PBIL Back to PBIL home page