(data stored in SCRATCH zone)

EMBL: CP001778.PE46

CP001778.PE46        Location/Qualifiers
FT   CDS             complement(53814..54560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0047"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   oan:Oant_2067 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39769"
FT                   /db_xref="GOA:D3QC35"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC35"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD39769.1"
FT                   /translation="MTMTKPMAQRFSGRLAVVTGASSGIGAAVCHRLTDEGARVLALDV
FT                   NAPRPQLAATVEFVRTDVASTEAWQRVAAVAAERGGADILVSNAATVDVAAAHETDDVS
FT                   WDRQLSVNLSAAFKGVRALLPQLRPRRGNVVIVSSVHAHMGLPGRPAYAAAKGGLCALG
FT                   RQLAAEYGPDLRVNSVIPGPILTPAWDWVSEADRHRSAAQTTLDRMGTPEELAACVAFL
FT                   ASDEASYVTGSELVVDGGWSITKDST"
     MTMTKPMAQR FSGRLAVVTG ASSGIGAAVC HRLTDEGARV LALDVNAPRP QLAATVEFVR        60
     TDVASTEAWQ RVAAVAAERG GADILVSNAA TVDVAAAHET DDVSWDRQLS VNLSAAFKGV       120
     RALLPQLRPR RGNVVIVSSV HAHMGLPGRP AYAAAKGGLC ALGRQLAAEY GPDLRVNSVI       180
     PGPILTPAWD WVSEADRHRS AAQTTLDRMG TPEELAACVA FLASDEASYV TGSELVVDGG       240
     WSITKDST                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page