(data stored in SCRATCH zone)

EMBL: CP001778.PE463

CP001778.PE463       Location/Qualifiers
FT   CDS             491759..492871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0471"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="PFAM: aminotransferase class I and II;
FT                   aminotransferase class-III; aromatic amino acid beta-
FT                   eliminating lyase/threonine aldolase; KEGG: mxa:MXAN_1258
FT                   8-amino-7-oxononanoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40186"
FT                   /db_xref="GOA:D3Q4M6"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q4M6"
FT                   /inference="protein motif:PRIAM:2.3.1.47"
FT                   /protein_id="ADD40186.1"
FT                   /translation="MIWQSTLDNKARLRRNAGLDRTLRVRAADDPLIDLAGNDYLGLAR
FT                   HPTVTAAAAEALAEYGLGAGGSRLVRGTTDAHVALENRLGELLGGAALVYSSGYLANLG
FT                   AIRALCDASTMLVRDAHAHASLIDGCQLAGARLVTMPHNDIDALDRILAGHNRRSVVVV
FT                   ESVYSVDGDLAPLAELHRVCRAHGAILLVDEAHAVGVLGPGGAGASAASGLKAASDLVI
FT                   TATLSKALGSAGGVVAGPAELRRHLVDTGRTFIFDTAPPPAVAAGALAALELAAADDEL
FT                   RAEVSRRASAAAERLGVAAPAAGVVSVPASDPHAALEWARRCAEAGVAVGCFRPPSTPD
FT                   GSSRLRLTVNAGIPVADFNNAIDVIERERP"
     MIWQSTLDNK ARLRRNAGLD RTLRVRAADD PLIDLAGNDY LGLARHPTVT AAAAEALAEY        60
     GLGAGGSRLV RGTTDAHVAL ENRLGELLGG AALVYSSGYL ANLGAIRALC DASTMLVRDA       120
     HAHASLIDGC QLAGARLVTM PHNDIDALDR ILAGHNRRSV VVVESVYSVD GDLAPLAELH       180
     RVCRAHGAIL LVDEAHAVGV LGPGGAGASA ASGLKAASDL VITATLSKAL GSAGGVVAGP       240
     AELRRHLVDT GRTFIFDTAP PPAVAAGALA ALELAAADDE LRAEVSRRAS AAAERLGVAA       300
     PAAGVVSVPA SDPHAALEWA RRCAEAGVAV GCFRPPSTPD GSSRLRLTVN AGIPVADFNN       360
     AIDVIERERP                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page