(data stored in SCRATCH zone)

EMBL: CP001778.PE469

CP001778.PE469       Location/Qualifiers
FT   CDS             497403..498803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0477"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; SMART: Integrin alpha
FT                   beta-propellor repeat protein; KEGG: noc:Noc_2093 integrins
FT                   alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40192"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5P3"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ADD40192.1"
FT                   /translation="MRKSRLSPRARKAGVITLAVAVGVTTVGAAAVAYADPAESSVPTS
FT                   SDFDGDGKDDLAMSAQKTDEAAEDSVVIDYTTGLANKELYPESAYGTDGFGVGLAAGDL
FT                   NGDGFDDLAVGCVNCDWEWGGATVSIYNGSAEGLKPDSAVNAEVGDPTYAVGIGELNGG
FT                   GSLDVGSTRLGDASAVSSRGDDGWWSDKWVNTGMPTDENRLGSVAIGDVNGDGKDDLVI
FT                   GTPTADGGSITLFPGPVTEGKKDTVKAVELSPTLRDLGASLAVTDVTGDGLADVIAGAP
FT                   TSTVGGTSCGAVQLLIGKTNGIAADFSQRLTQESANIPGVCEAGDDWGRSVAAGNVDGD
FT                   AGAEVVVGVPGEGIDSLGKAGTYTTLQSTSTGLTGTGSFGVSQATANVPGTAESGDGFA
FT                   SALALRDVNDDGRMDVVIGAPTEDVSTVKDAGQVVTALSSATGAPAAGTTEVTGNKYGL
FT                   KRLGWELA"
     MRKSRLSPRA RKAGVITLAV AVGVTTVGAA AVAYADPAES SVPTSSDFDG DGKDDLAMSA        60
     QKTDEAAEDS VVIDYTTGLA NKELYPESAY GTDGFGVGLA AGDLNGDGFD DLAVGCVNCD       120
     WEWGGATVSI YNGSAEGLKP DSAVNAEVGD PTYAVGIGEL NGGGSLDVGS TRLGDASAVS       180
     SRGDDGWWSD KWVNTGMPTD ENRLGSVAIG DVNGDGKDDL VIGTPTADGG SITLFPGPVT       240
     EGKKDTVKAV ELSPTLRDLG ASLAVTDVTG DGLADVIAGA PTSTVGGTSC GAVQLLIGKT       300
     NGIAADFSQR LTQESANIPG VCEAGDDWGR SVAAGNVDGD AGAEVVVGVP GEGIDSLGKA       360
     GTYTTLQSTS TGLTGTGSFG VSQATANVPG TAESGDGFAS ALALRDVNDD GRMDVVIGAP       420
     TEDVSTVKDA GQVVTALSSA TGAPAAGTTE VTGNKYGLKR LGWELA                      466
//

If you have problems or comments...

PBIL Back to PBIL home page