(data stored in SCRATCH zone)

EMBL: CP001778.PE47

CP001778.PE47        Location/Qualifiers
FT   CDS             54675..55979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0048"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ret:RHE_PB00150 sugar ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39770"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3QC36"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADD39770.1"
FT                   /translation="MPSLSRRTALRLAAAALLPTSLAACGGGGSGRRQPGETIELTFWN
FT                   WVPGVDKAVNLWNKQNPEVQIRLSNIPSGPSGGYAKMFAALKAGDPPDLAQVEYYQIPA
FT                   FLMEQGLEDLTQHGFADHKDKFVDWQWDQGAFGDGVYAVPQASGPMAMYYRADLLEQWN
FT                   LEPPATWAEFEETAAKIREHDAYICSFPPNDAAMFTSLCWQAGARWFGTSGGEWTVDMD
FT                   NEPTRKVAEYWQRLIKKDLVLAQPMMANAWYKAVQDGKEVLWVGPQWGDALIKGNAPKT
FT                   SGKWKVTGMPQWKEGEFASANWGGSSTALFKGGDFPAEALEFAIWLNTDPTAVDLLIEG
FT                   GYGWPAAAGVFKGSKLDRDDEFFGGRYNDVFAEADKAVDTKWRWTPITLEINENLNAGF
FT                   QAAFGSGGSFTDVVATAEKQAIAGMKAKGLPVASP"
     MPSLSRRTAL RLAAAALLPT SLAACGGGGS GRRQPGETIE LTFWNWVPGV DKAVNLWNKQ        60
     NPEVQIRLSN IPSGPSGGYA KMFAALKAGD PPDLAQVEYY QIPAFLMEQG LEDLTQHGFA       120
     DHKDKFVDWQ WDQGAFGDGV YAVPQASGPM AMYYRADLLE QWNLEPPATW AEFEETAAKI       180
     REHDAYICSF PPNDAAMFTS LCWQAGARWF GTSGGEWTVD MDNEPTRKVA EYWQRLIKKD       240
     LVLAQPMMAN AWYKAVQDGK EVLWVGPQWG DALIKGNAPK TSGKWKVTGM PQWKEGEFAS       300
     ANWGGSSTAL FKGGDFPAEA LEFAIWLNTD PTAVDLLIEG GYGWPAAAGV FKGSKLDRDD       360
     EFFGGRYNDV FAEADKAVDT KWRWTPITLE INENLNAGFQ AAFGSGGSFT DVVATAEKQA       420
     IAGMKAKGLP VASP                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page