(data stored in SCRATCH zone)

EMBL: CP001778.PE50

CP001778.PE50        Location/Qualifiers
FT   CDS             57727..59718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0051"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /note="PFAM: Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein;
FT                   Beta-galactosidase domain protein; KEGG: esa:ESA_03417
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39773"
FT                   /db_xref="GOA:D3Q0A9"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0A9"
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /protein_id="ADD39773.1"
FT                   /translation="MARFNERLSRIAFGGDYNPEQWDEEVWAEDMRLMTEAGVSMVSLG
FT                   IFSWAKVEPRPGEYDFGWVDRIFELLSANDIAVCLATMTASPPPWLARLHPETLPMLPD
FT                   GSRLWPGGRQHYCPSSPEYRRYATRLVAKLAERYGDHPALAMWHIGNEYGCHVPECFCD
FT                   VSAVAFRGWLRERYGDLDTLNDAWSTSFWSQAYGDWDEIFPPRSVPAFHNPAQRLDFSR
FT                   FSSDELLACYLAETEITNRVTPNVPVTTNFVGAWRRINTMKWARHMDVVSYDSYPDPHD
FT                   PEAAADSALAYDLMRSLRDGQPWLLMEQAPSAVNWRERNGAKPRDVMRLWSWQAIAHGA
FT                   DSVLYFQWRASRGGAERFHSGMVPHAGENTRIHREIRQLGNELKGHSALVGTRQTCDVA
FT                   LVIDWDSGWAVEGTSHPSDDVRLMDAVAAHHRPLYDANVAVDFVRPGADLSKYKLVVVP
FT                   NLYLVSEADARNISDYVHGGGTVLMSFFSGIVDEYDRVHLGGYPAPFRELLGLWIEEFW
FT                   PLPRGGSTGISFDGDLSALGSDTATRWSEVIRTEGAETLATFAGGDLDGEPAATRHRFG
FT                   DGEAYYLGTRPSPERMRSLLDHLRQRTAVAPTLADLPDGVQARTRVGEDGTAHHILLNH
FT                   TARPVTVTVDGAAVELAAHDVAVVTAKA"
     MARFNERLSR IAFGGDYNPE QWDEEVWAED MRLMTEAGVS MVSLGIFSWA KVEPRPGEYD        60
     FGWVDRIFEL LSANDIAVCL ATMTASPPPW LARLHPETLP MLPDGSRLWP GGRQHYCPSS       120
     PEYRRYATRL VAKLAERYGD HPALAMWHIG NEYGCHVPEC FCDVSAVAFR GWLRERYGDL       180
     DTLNDAWSTS FWSQAYGDWD EIFPPRSVPA FHNPAQRLDF SRFSSDELLA CYLAETEITN       240
     RVTPNVPVTT NFVGAWRRIN TMKWARHMDV VSYDSYPDPH DPEAAADSAL AYDLMRSLRD       300
     GQPWLLMEQA PSAVNWRERN GAKPRDVMRL WSWQAIAHGA DSVLYFQWRA SRGGAERFHS       360
     GMVPHAGENT RIHREIRQLG NELKGHSALV GTRQTCDVAL VIDWDSGWAV EGTSHPSDDV       420
     RLMDAVAAHH RPLYDANVAV DFVRPGADLS KYKLVVVPNL YLVSEADARN ISDYVHGGGT       480
     VLMSFFSGIV DEYDRVHLGG YPAPFRELLG LWIEEFWPLP RGGSTGISFD GDLSALGSDT       540
     ATRWSEVIRT EGAETLATFA GGDLDGEPAA TRHRFGDGEA YYLGTRPSPE RMRSLLDHLR       600
     QRTAVAPTLA DLPDGVQART RVGEDGTAHH ILLNHTARPV TVTVDGAAVE LAAHDVAVVT       660
     AKA                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page