(data stored in SCRATCH zone)

EMBL: CP001778.PE506

CP001778.PE506       Location/Qualifiers
FT   CDS             complement(538863..539867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0514"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: rec:RHECIAT_CH0003526 probable transcriptional
FT                   regulator protein, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40229"
FT                   /db_xref="GOA:D3Q5T0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5T0"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADD40229.1"
FT                   /translation="MTHHVAVLLFDDTSGFTAGMAAEVFGRPAPEPGLDWYELSMCAQR
FT                   PGVVTALGGARFDTPHGLDVFAAADTVIVPGVPNMTDPPSPEVVTAVRQAHRRGARVVS
FT                   LCSGTFALAGAGILDGRRAATHWAHAAELRGRHPLVAVDSDVLYIDDGDILTSAGQAAG
FT                   LDLCLHLVRKDFGAAIANRVARRLVVQPHREGGQAQFIETPLSADPEDDRLAASMAWAA
FT                   ANLDKPVTITVLAERAHMSPRHYQRNFARSTGTSPIRWLIEQRVRASLALLETTESSIE
FT                   QVSAAVGFDTSVTFRHHFARLMRTSPSAYRRAFRGGATAQVSLAAVFTVTGAC"
     MTHHVAVLLF DDTSGFTAGM AAEVFGRPAP EPGLDWYELS MCAQRPGVVT ALGGARFDTP        60
     HGLDVFAAAD TVIVPGVPNM TDPPSPEVVT AVRQAHRRGA RVVSLCSGTF ALAGAGILDG       120
     RRAATHWAHA AELRGRHPLV AVDSDVLYID DGDILTSAGQ AAGLDLCLHL VRKDFGAAIA       180
     NRVARRLVVQ PHREGGQAQF IETPLSADPE DDRLAASMAW AAANLDKPVT ITVLAERAHM       240
     SPRHYQRNFA RSTGTSPIRW LIEQRVRASL ALLETTESSI EQVSAAVGFD TSVTFRHHFA       300
     RLMRTSPSAY RRAFRGGATA QVSLAAVFTV TGAC                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page