(data stored in SCRATCH zone)

EMBL: CP001778.PE517

CP001778.PE517       Location/Qualifiers
FT   CDS             complement(549495..550274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0525"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   rle:RL2976 putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40240"
FT                   /db_xref="GOA:D3Q5U1"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5U1"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADD40240.1"
FT                   /translation="MTPRIAYLGTRFKALLAYRFEIIIWLIGPLLQMLLLATVWRAVYD
FT                   GRSTVDGVSLAVMTTYVTISTIHSLIAHDDMDDWVHERVNTGGVGVDLLRPLPFMEQTL
FT                   WGSVAQLGIKLLMIVVVLPVGAVFAGLSAPAHLGLYLIAAVLAWLVNLCMYLLLSSIVF
FT                   WTLEVHGLNFMYFVVNAFLSGALVPLWFMPDWLATALSWLPFQAIVFTPASIYVGQLTG
FT                   TAAWQAIGVQFTWLVLLSATAVLVWRRAVRKTVVQGG"
     MTPRIAYLGT RFKALLAYRF EIIIWLIGPL LQMLLLATVW RAVYDGRSTV DGVSLAVMTT        60
     YVTISTIHSL IAHDDMDDWV HERVNTGGVG VDLLRPLPFM EQTLWGSVAQ LGIKLLMIVV       120
     VLPVGAVFAG LSAPAHLGLY LIAAVLAWLV NLCMYLLLSS IVFWTLEVHG LNFMYFVVNA       180
     FLSGALVPLW FMPDWLATAL SWLPFQAIVF TPASIYVGQL TGTAAWQAIG VQFTWLVLLS       240
     ATAVLVWRRA VRKTVVQGG                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page