(data stored in SCRATCH zone)

EMBL: CP001778.PE53

CP001778.PE53        Location/Qualifiers
FT   CDS             61314..61547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39776"
FT                   /db_xref="GOA:D3Q0B2"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39776.1"
FT                   /translation="MRKVLQVLGLYLVIAGISGTLDHVAIQPIMGVVFNAFNRFLLPHL
FT                   DALKGYEVPANLSLSVVGAVLLLAVGRREKTA"
     MRKVLQVLGL YLVIAGISGT LDHVAIQPIM GVVFNAFNRF LLPHLDALKG YEVPANLSLS        60
     VVGAVLLLAV GRREKTA                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page