(data stored in SCRATCH zone)

EMBL: CP001778.PE540

CP001778.PE540       Location/Qualifiers
FT   CDS             complement(581621..582223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40263"
FT                   /db_xref="GOA:D3Q5W4"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5W4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD40263.1"
FT                   /translation="MTYPQQPGYGQQPGYGQQPQQPGYGQQQPGYGQQPQQPAYGQPQQ
FT                   PGYGQQQPGYSSPDYGQPPQQPGGGGQAWITVDAQYFVLNFILSFFKPKIFIDGQQMQG
FT                   TEWKANTFPVVPGTHHVKVVTPYLWDFGEAETQVTVGPGQNVPLEYKSPLVAFFVPGSL
FT                   GPSPQQYNGMGLMIGLMAVPLALLVLVCICSLGGFWI"
     MTYPQQPGYG QQPGYGQQPQ QPGYGQQQPG YGQQPQQPAY GQPQQPGYGQ QQPGYSSPDY        60
     GQPPQQPGGG GQAWITVDAQ YFVLNFILSF FKPKIFIDGQ QMQGTEWKAN TFPVVPGTHH       120
     VKVVTPYLWD FGEAETQVTV GPGQNVPLEY KSPLVAFFVP GSLGPSPQQY NGMGLMIGLM       180
     AVPLALLVLV CICSLGGFWI                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page