(data stored in SCRATCH zone)

EMBL: CP001778.PE55

CP001778.PE55        Location/Qualifiers
FT   CDS             complement(62666..63208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_3566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADD39778"
FT                   /db_xref="GOA:D3Q0B4"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q0B4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD39778.1"
FT                   /translation="MSAQRTEALALLGPATDRLIDTVRGLSDAQLRADSLLPGWSRGHV
FT                   LTHVARQADAMCNLLTWASTGVETPAYASQESRAADIEAGSGRSADELVADLRASAERF
FT                   LAKVAETSDDAWGAQVRVLNSELFPAEQTVSRRLAEVELHHVDLGLEYRAADWPKQFAD
FT                   IELPEPSATFRAERASW"
     MSAQRTEALA LLGPATDRLI DTVRGLSDAQ LRADSLLPGW SRGHVLTHVA RQADAMCNLL        60
     TWASTGVETP AYASQESRAA DIEAGSGRSA DELVADLRAS AERFLAKVAE TSDDAWGAQV       120
     RVLNSELFPA EQTVSRRLAE VELHHVDLGL EYRAADWPKQ FADIELPEPS ATFRAERASW       180
//

If you have problems or comments...

PBIL Back to PBIL home page