(data stored in SCRATCH zone)

EMBL: CP001778.PE555

CP001778.PE555       Location/Qualifiers
FT   CDS             596464..597516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0564"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mxa:MXAN_2051 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40278"
FT                   /db_xref="GOA:D3Q5X9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5X9"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADD40278.1"
FT                   /translation="MREPLILGIESSCDETGVGIVRGLELLANEVASSVEQHARFGGVI
FT                   PEVASRAHLEAMVPTMRRALDVAGVKLSDVDAIAVTAGPGLSGALLVGLAAAKAYALAA
FT                   GKPLYGVNHLDAHIAVDTLENGPLPKPSLGLLVSGGHTELLYVEDLAGKVRLLGQTLDD
FT                   AAGEAYDKVGRILGMPYPAGPHIDAAARLGDPTAIDFPRGLTGPRDLAKHRYDFSFSGL
FT                   KTAVARWIEARQREGAEIPVNDVAASFQEAVCDVLTAKAIDAAREHGIDTLLLGGGVAA
FT                   NSRLRELAQERCDAAGLTLRFPSRKLCTDNGAMVAALGSHLVAAGVTESRMDIPADSSL
FT                   AVETVSLANA"
     MREPLILGIE SSCDETGVGI VRGLELLANE VASSVEQHAR FGGVIPEVAS RAHLEAMVPT        60
     MRRALDVAGV KLSDVDAIAV TAGPGLSGAL LVGLAAAKAY ALAAGKPLYG VNHLDAHIAV       120
     DTLENGPLPK PSLGLLVSGG HTELLYVEDL AGKVRLLGQT LDDAAGEAYD KVGRILGMPY       180
     PAGPHIDAAA RLGDPTAIDF PRGLTGPRDL AKHRYDFSFS GLKTAVARWI EARQREGAEI       240
     PVNDVAASFQ EAVCDVLTAK AIDAAREHGI DTLLLGGGVA ANSRLRELAQ ERCDAAGLTL       300
     RFPSRKLCTD NGAMVAALGS HLVAAGVTES RMDIPADSSL AVETVSLANA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page