(data stored in SCRATCH zone)

EMBL: CP001778.PE569

CP001778.PE569       Location/Qualifiers
FT   CDS             607948..609225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Snas_0578"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_3030 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Snas_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADD40292"
FT                   /db_xref="GOA:D3Q5Z3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3Q5Z3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD40292.1"
FT                   /translation="MFGSYRRLFARPGVMGMTGLSLSVKLGPPTLSLALLLVVFDDTGS
FT                   YAVAGLTLTGHALALALCAPLGGRLVDRFSPRKVLPPYLLVHAAAYTLVLLSIHLPVPA
FT                   PLVVAAAAVLGATSPPAGAVIRGAWPRLVAPGSLNTAYALDNAINELMFIAGPVLVAGL
FT                   LLVMPASAIIIVTGTVFLAAVAAVTMSRVVRTAAPGAPTGDGPSRGRLTRLVGPLAHRP
FT                   TLILLFIAALGTFTFGSLRVAMVASATVLGSAGAAGIFAGLLSAGTLAAGLGYGGRHWS
FT                   ITGRRLLGILFAADCVLLFAGVFDVGYLWLAVVITAIGAVSGPRDTLIPVILTEHAPAT
FT                   ARTEVFAWLNTFMWIGYGLGTAVAGQLTGPKDSGAAAFVTAGIVAAGGILVSALLPRAT
FT                   TAPDPAERSGESGEVLVEHAESRGRR"
     MFGSYRRLFA RPGVMGMTGL SLSVKLGPPT LSLALLLVVF DDTGSYAVAG LTLTGHALAL        60
     ALCAPLGGRL VDRFSPRKVL PPYLLVHAAA YTLVLLSIHL PVPAPLVVAA AAVLGATSPP       120
     AGAVIRGAWP RLVAPGSLNT AYALDNAINE LMFIAGPVLV AGLLLVMPAS AIIIVTGTVF       180
     LAAVAAVTMS RVVRTAAPGA PTGDGPSRGR LTRLVGPLAH RPTLILLFIA ALGTFTFGSL       240
     RVAMVASATV LGSAGAAGIF AGLLSAGTLA AGLGYGGRHW SITGRRLLGI LFAADCVLLF       300
     AGVFDVGYLW LAVVITAIGA VSGPRDTLIP VILTEHAPAT ARTEVFAWLN TFMWIGYGLG       360
     TAVAGQLTGP KDSGAAAFVT AGIVAAGGIL VSALLPRATT APDPAERSGE SGEVLVEHAE       420
     SRGRR                                                                   425
//

If you have problems or comments...

PBIL Back to PBIL home page